DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and pear1

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_017952446.2 Gene:pear1 / 100489801 XenbaseID:XB-GENE-6045593 Length:1087 Species:Xenopus tropicalis


Alignment Length:330 Identity:82/330 - (24%)
Similarity:124/330 - (37%) Gaps:73/330 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IWALILVLGSIAANAERDNYCERNETIRATVPVTKQRIIVKQP----------SKWKIWKKTEKI 58
            :|.|:.:....:.:....|.|...|:....|..:     ..||          |.|..:|.....
 Frog    11 VWMLVQIQFGKSLSPNDPNVCSFWESFTLAVKES-----YTQPYSQLSPDSCDSSWNYFKACTPQ 70

  Fly    59 TEIYDSEEEQVTHRLVRE------CCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISGYVS 117
            ..:|   .....||:..:      ||.||.: .:.:|.|.|::.| .|..|.|||:|:|..|:  
 Frog    71 KILY---RTAYRHRVKLDYRRRYWCCKGYYE-SNDICVPRCTQEC-VHGRCIAPDQCQCEPGW-- 128

  Fly   118 ARNHQDGSHYCE-----PICETPCPA---GAQCVTPNTCAC----RDGYTQLQPTDDGV-SGGCA 169
              ..:|.|..||     |.|.:.||.   ||......||.|    ||.:.: :|.|.|. .|||:
 Frog   129 --RGKDCSSACEAHVWGPKCNSTCPCQNNGACDAASGTCICPPGFRDPFCE-KPCDPGTYGGGCS 190

  Fly   170 PVCRVGDGCANGKCIDVDR--CACNSGYRWDKAEERCIELSAE--SISEELETTEDNTDSPSTSS 230
            ..|:    |.||...|.:.  |.|..||.....|.||.|:...  |.|::.........:.|:..
 Frog   191 LSCQ----CKNGAECDPENGACLCPEGYTGPYCEIRCKEVQPANFSCSDQCLCQSGGICNQSSGE 251

  Fly   231 TAV-------FTATHCPDDFVLFRGECREKQFDSNDVGCLKSG-CGPHQTCLDSGVCQCSDGYVP 287
            .:.       ..:..|||.:  :...|:::..      |...| |.|     .:|.|.||:||..
 Frog   252 CSCPPGWMGSLCSIPCPDGY--YGRNCKQECL------CHNGGQCDP-----KTGQCLCSEGYTG 303

  Fly   288 EESGE 292
            :...|
 Frog   304 DHCRE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
pear1XP_017952446.2 EMI 29..97 CDD:400092 15/75 (20%)
exchanger_TraA <147..>310 CDD:411343 46/180 (26%)
exchanger_TraA <416..729 CDD:411343
Laminin_EGF 546..586 CDD:395007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.