DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and AT1G17230

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001322898.1 Gene:AT1G17230 / 838294 AraportID:AT1G17230 Length:1133 Species:Arabidopsis thaliana


Alignment Length:518 Identity:127/518 - (24%)
Similarity:182/518 - (35%) Gaps:150/518 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GFFVR-FDHLLHLELQHSGLSDLDDFSLNG--------LTKLQYLSLSHNNLS------------ 100
            ||..: |.|:|:|:|.|     |.:..|.|        ||.|:.|.||.|.|:            
plant   321 GFIPKEFGHILNLKLLH-----LFENILLGPIPRELGELTLLEKLDLSINRLNGTIPQELQFLPY 380

  Fly   101 --SLRSWSSE------PL-GALTN---LDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRIS-QIEN 152
              .|:.:.::      || |..:|   ||:|.|.||......|.::..|..|.|..|::| .|..
plant   381 LVDLQLFDNQLEGKIPPLIGFYSNFSVLDMSANSLSGPIPAHFCRFQTLILLSLGSNKLSGNIPR 445

  Fly   153 DSFDGLSHLKHLYLNGNQLAHIDGSF---FRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRL 214
            | ......|..|.|..|||.   ||.   ...|..|::|.|..|.:............:|..|||
plant   446 D-LKTCKSLTKLMLGDNQLT---GSLPIELFNLQNLTALELHQNWLSGNISADLGKLKNLERLRL 506

  Fly   215 DQNLLSSLQFLSQ-----RGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEA 274
            ..|     .|..:     ..|.::|..|:|||.|....|........:|.||||.|..:....:.
plant   507 ANN-----NFTGEIPPEIGNLTKIVGFNISSNQLTGHIPKELGSCVTIQRLDLSGNKFSGYIAQE 566

  Fly   275 LSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLT----------------------- 316
            |..|..||.|.:|.|.:......|...|..|::|.:..|||:                       
plant   567 LGQLVYLEILRLSDNRLTGEIPHSFGDLTRLMELQLGGNLLSENIPVELGKLTSLQISLNISHNN 631

  Fly   317 ---TLPDNLFHFNTQLEEIILAN-NKIEEISSQMMFNQNHLRYIKLSGN----AISDAAFLDRLS 373
               |:||:|  .|.|:.||:..| ||:.......:.|...|....:|.|    .:.|.|...|:.
plant   632 LSGTIPDSL--GNLQMLEILYLNDNKLSGEIPASIGNLMSLLICNISNNNLVGTVPDTAVFQRMD 694

  Fly   374 PSVNRFTLYVDLSSNRLKSLNLSSLLHFRYINLADNNWSCNWLVANLVQKLPNS---VNFARPWT 435
            .|                             |.|.|:..||...::....:|:|   :|    | 
plant   695 SS-----------------------------NFAGNHGLCNSQRSHCQPLVPHSDSKLN----W- 725

  Fly   436 VINNLSENTTNVEGIDCIEGGTNRSIILLDVSGVPQPKSDNCDC----------VVAYDETNP 488
            :||  ......:..|.||..|   |:.|:...|:         |          |...|:|.|
plant   726 LIN--GSQRQKILTITCIVIG---SVFLITFLGL---------CWTIKRREPAFVALEDQTKP 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 3/7 (43%)
LRR_8 64..123 CDD:290566 25/90 (28%)
leucine-rich repeat 65..88 CDD:275380 8/30 (27%)
leucine-rich repeat 89..112 CDD:275380 9/43 (21%)
leucine-rich repeat 113..136 CDD:275380 8/25 (32%)
LRR_RI 115..384 CDD:238064 81/311 (26%)
LRR_8 135..195 CDD:290566 20/63 (32%)
leucine-rich repeat 137..160 CDD:275380 7/23 (30%)
leucine-rich repeat 161..184 CDD:275380 9/25 (36%)
LRR_8 184..243 CDD:290566 16/63 (25%)
leucine-rich repeat 185..208 CDD:275380 4/22 (18%)
leucine-rich repeat 209..232 CDD:275380 7/27 (26%)
LRR_8 232..289 CDD:290566 19/56 (34%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
LRR_8 280..339 CDD:290566 22/85 (26%)
leucine-rich repeat 281..304 CDD:275380 7/22 (32%)
leucine-rich repeat 305..328 CDD:275380 10/48 (21%)
AT1G17230NP_001322898.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.