DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and GSO2

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_199283.1 Gene:GSO2 / 834499 AraportID:AT5G44700 Length:1252 Species:Arabidopsis thaliana


Alignment Length:576 Identity:149/576 - (25%)
Similarity:227/576 - (39%) Gaps:153/576 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SKCNNTEVTLIRKTEL---LTSLTLSNCTLPHVENGFFVRFDHLLHLELQHSGLSDLDDFSLNGL 86
            |.||.|.||...:..:   |:.|.|:....|.:.     ||::|:|::|..:.|......:|:.|
plant    59 SYCNWTGVTCGGREIIGLNLSGLGLTGSISPSIG-----RFNNLIHIDLSSNRLVGPIPTTLSNL 118

  Fly    87 -TKLQYLSLSHNNLS-SLRSWSSEPLGALTN---LDLSHNMLSKLSVKSFEQYPQLQQLDLRYNR 146
             :.|:.|.|..|.|| .:.|    .||:|.|   |.|..|.|:....::|.....||.|.|...|
plant   119 SSSLESLHLFSNLLSGDIPS----QLGSLVNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCR 179

  Fly   147 ISQIENDSFDGLSHLKHLYLNGNQL-----AHIDGS-----FFRGLHRLS-SLSLQHNRIEFIEM 200
            ::.:....|..|..|:.|.|..|:|     |.|...     |....:||: ||..:.||::    
plant   180 LTGLIPSRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLK---- 240

  Fly   201 DSFESNTHLRSLRLDQNLLSSLQFLSQRG-LARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSY 264
                   :|::|.|..|..|. :..||.| |..:.:|||..|.||.|.|...::...||.||||.
plant   241 -------NLQTLNLGDNSFSG-EIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDLSS 297

  Fly   265 NNIT--------KLN--------KEALSGL---------DSLERLNISHNYVDKIYDESLDSLIA 304
            ||:|        ::|        |..|||.         .||::|.:|...:.......:.:..:
plant   298 NNLTGVIHEEFWRMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQS 362

  Fly   305 LLQLDISFNLLT-TLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLR-----YIKLSGNAI 363
            |..||:|.|.|| .:||:||.. .:|..:.|.||.:|...|..:.|..:|:     :..|.|...
plant   363 LKLLDLSNNTLTGQIPDSLFQL-VELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVP 426

  Fly   364 SDAAFLDRLSPSV---NRFT-------------LYVDLSSNRLKSLNLSSL--------LHFR-- 402
            .:..||.:|....   |||:             ..:|...|||.....||:        ||.|  
plant   427 KEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLREN 491

  Fly   403 -----------------YINLADNNWSCNWLVANLVQKLPNSVNFARP---WTVIN-----NLSE 442
                             .|:||||         .|...:|:|..|...   :.:.|     ||.:
plant   492 ELVGNIPASLGNCHQMTVIDLADN---------QLSGSIPSSFGFLTALELFMIYNNSLQGNLPD 547

  Fly   443 NTTNVEGIDCIEGGTNR------------SIILLDVS------GVPQP--KSDNCD 478
            :..|::.:..|...:|:            |.:..||:      .:|..  ||.|.|
plant   548 SLINLKNLTRINFSSNKFNGSISPLCGSSSYLSFDVTENGFEGDIPLELGKSTNLD 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 6/22 (27%)
LRR_8 64..123 CDD:290566 20/63 (32%)
leucine-rich repeat 65..88 CDD:275380 6/23 (26%)
leucine-rich repeat 89..112 CDD:275380 8/23 (35%)
leucine-rich repeat 113..136 CDD:275380 7/25 (28%)
LRR_RI 115..384 CDD:238064 89/330 (27%)
LRR_8 135..195 CDD:290566 20/70 (29%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
leucine-rich repeat 161..184 CDD:275380 8/32 (25%)
LRR_8 184..243 CDD:290566 19/60 (32%)
leucine-rich repeat 185..208 CDD:275380 5/23 (22%)
leucine-rich repeat 209..232 CDD:275380 9/23 (39%)
LRR_8 232..289 CDD:290566 26/81 (32%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
leucine-rich repeat 257..280 CDD:275380 14/47 (30%)
LRR_8 280..339 CDD:290566 19/59 (32%)
leucine-rich repeat 281..304 CDD:275380 3/22 (14%)
leucine-rich repeat 305..328 CDD:275380 11/23 (48%)
GSO2NP_199283.1 LRRNT_2 28..68 CDD:285463 5/8 (63%)
leucine-rich repeat 76..96 CDD:275380 6/24 (25%)
LRR_RI 135..406 CDD:238064 83/287 (29%)
LRR_8 145..204 CDD:290566 17/58 (29%)
leucine-rich repeat 146..169 CDD:275380 5/22 (23%)
leucine-rich repeat 170..193 CDD:275380 7/22 (32%)
leucine-rich repeat 194..241 CDD:275380 14/57 (25%)
LRR_8 240..300 CDD:290566 24/71 (34%)
leucine-rich repeat 242..265 CDD:275380 9/23 (39%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
PLN00113 285..1232 CDD:215061 77/329 (23%)
leucine-rich repeat 290..313 CDD:275380 9/22 (41%)
leucine-rich repeat 314..338 CDD:275380 4/23 (17%)
leucine-rich repeat 339..362 CDD:275380 3/22 (14%)
leucine-rich repeat 363..386 CDD:275380 11/23 (48%)
leucine-rich repeat 387..410 CDD:275380 7/22 (32%)
leucine-rich repeat 411..434 CDD:275380 5/22 (23%)
leucine-rich repeat 435..458 CDD:275380 4/22 (18%)
leucine-rich repeat 459..482 CDD:275380 6/22 (27%)
leucine-rich repeat 483..506 CDD:275380 3/22 (14%)
leucine-rich repeat 507..528 CDD:275380 8/29 (28%)
leucine-rich repeat 531..554 CDD:275380 4/22 (18%)
leucine-rich repeat 555..571 CDD:275380 2/15 (13%)
LRR_RI 603..843 CDD:238064 1/1 (100%)
leucine-rich repeat 604..625 CDD:275380 149/576 (26%)
leucine-rich repeat 626..649 CDD:275380
leucine-rich repeat 650..673 CDD:275380
leucine-rich repeat 674..697 CDD:275380
leucine-rich repeat 698..721 CDD:275380
leucine-rich repeat 722..745 CDD:275380
leucine-rich repeat 746..769 CDD:275380
leucine-rich repeat 770..794 CDD:275380
leucine-rich repeat 795..818 CDD:275380
leucine-rich repeat 819..839 CDD:275380
STKc_IRAK 954..1232 CDD:270968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.