DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and PODNL1

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_011526610.1 Gene:PODNL1 / 79883 HGNCID:26275 Length:579 Species:Homo sapiens


Alignment Length:425 Identity:120/425 - (28%)
Similarity:173/425 - (40%) Gaps:106/425 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIFSFSPRLSCLQLSKCNNTEVT-------LIRKTELLTSLTLSN-------CTLP------HVE 55
            |.|...|.|..:.|   :|.:::       ..|.:|.:.:|:|||       .:||      |::
Human   161 LTFGEKPALRSVYL---HNNQLSNAGLPPDAFRGSEAIATLSLSNNQLSYLPPSLPPSLERLHLQ 222

  Fly    56 N--------GFFVRFDHLLHLELQHSGLSD--LDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPL 110
            |        |...|...|..|.|||:.|:|  ||..:.:.|..|:||.||||.|:::      |.
Human   223 NNLISKVPRGALSRQTQLRELYLQHNQLTDSGLDATTFSKLHSLEYLDLSHNQLTTV------PA 281

  Fly   111 GALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHID 175
            |....|.:.|                     |..|||.|:|.....|...|::|.|..|||    
Human   282 GLPRTLAILH---------------------LGRNRIRQVEAARLHGARGLRYLLLQHNQL---- 321

  Fly   176 GSF---------FRGLH------------------RLSSLSLQHNRIEFIEMDSFESNTHLRSLR 213
            ||.         .||||                  ||.:|.|.||.:..:......:...|..|.
Human   322 GSSGLPAGALRPLRGLHTLHLYGNGLDRVPPALPRRLRALVLPHNHVAALGARDLVATPGLTELN 386

  Fly   214 LDQNLLSS--LQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALS 276
            |..|.|:|  :...:.|.|..|..|:|:.|.|.:| |......  |:.|.|..|.:..|..|.|:
Human   387 LAYNRLASARVHHRAFRRLRALRSLDLAGNQLTRL-PMGLPTG--LRTLQLQRNQLRMLEPEPLA 448

  Fly   277 GLDSLERLNISHN--YVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKI 339
            |||.|..|:::||  .|..|...:...|.||..||:|.|.|:.:|.:|   ...|||:.|..|:|
Human   449 GLDQLRELSLAHNRLRVGDIGPGTWHELQALQMLDLSHNELSFVPPDL---PEALEELHLEGNRI 510

  Fly   340 EEISSQMMFNQNHLRYIKLSGN-----AISDAAFL 369
            ..:..:...:...||.:.|..|     :|:..|||
Human   511 GHVGPEAFLSTPRLRALFLRANRLHMTSIAAEAFL 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 10/43 (23%)
LRR_8 64..123 CDD:290566 22/60 (37%)
leucine-rich repeat 65..88 CDD:275380 10/24 (42%)
leucine-rich repeat 89..112 CDD:275380 9/22 (41%)
leucine-rich repeat 113..136 CDD:275380 2/22 (9%)
LRR_RI 115..384 CDD:238064 82/291 (28%)
LRR_8 135..195 CDD:290566 25/86 (29%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
leucine-rich repeat 161..184 CDD:275380 12/49 (24%)
LRR_8 184..243 CDD:290566 18/60 (30%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..232 CDD:275380 8/24 (33%)
LRR_8 232..289 CDD:290566 19/56 (34%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 9/22 (41%)
LRR_8 280..339 CDD:290566 21/60 (35%)
leucine-rich repeat 281..304 CDD:275380 7/24 (29%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
PODNL1XP_011526610.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.