DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and fmodb

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_001338027.1 Gene:fmodb / 797559 ZFINID:ZDB-GENE-080327-28 Length:362 Species:Danio rerio


Alignment Length:360 Identity:94/360 - (26%)
Similarity:150/360 - (41%) Gaps:87/360 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NGLTKLQYL---------SLSHN-NLSSLRSWSSEP--LGALTNLD------------------- 117
            |.||.|.||         ..||| |.:|||: ..||  |......|                   
Zfish    23 NSLTWLSYLRNRAYSHGYGRSHNGNYASLRN-EDEPSVLDCPLECDCPPAYPKAMYCNNRKLQHV 86

  Fly   118 -----------LSHNMLSKLSVKSFEQYPQLQQLDLRYNRIS--QIENDSFDGLSHLKHLYLNGN 169
                       |.:|.::.::...|:..|.|..:.:..|:::  :|.:..|..|.:|:.|:|..|
Zfish    87 PFVPSHIKYVYLQNNQITGITNGVFDNAPNLTWIIMHANKLTSDKIGDKVFAKLPNLQRLFLQNN 151

  Fly   170 QLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLV 234
            .|:.:....   .|.|..|.|.||.|..:.::||...::|.:|.|..|.:..|. .:.:||..|.
Zfish   152 NLSRVPQDL---PHSLRDLHLNHNNISVVPLNSFHGMSNLTALYLQANAIEDLG-NALKGLLSLT 212

  Fly   235 HLNLSSNLL----QKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVD--- 292
            .|:|..|.|    |.|.|       :|..|.|.||.|:.:..:.||....|..:.:|||.:.   
Zfish   213 VLDLRGNRLKMIPQSLPP-------KLSQLYLEYNYISSIPADFLSQRPDLRFVRLSHNQLTNGG 270

  Fly   293 ---KIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMF------ 348
               ..::.|     .|::||:|||.|..:|.    .:|.||.:.|..|||:|.|.....      
Zfish   271 IPANAFNVS-----TLVELDLSFNKLERIPT----ISTSLENLYLQANKIKEFSVSSFCRVVDTN 326

  Fly   349 NQNHLRYIKLSGNAI------SDAAFLDRLSPSVN 377
            |.::||.::|..|.|      ::|....||:.:::
Zfish   327 NYSNLRVLRLEANEITPRDIPNEAVLCLRLATNID 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 19/80 (24%)
leucine-rich repeat 65..88 CDD:275380 2/3 (67%)
leucine-rich repeat 89..112 CDD:275380 13/34 (38%)
leucine-rich repeat 113..136 CDD:275380 4/52 (8%)
LRR_RI 115..384 CDD:238064 78/317 (25%)
LRR_8 135..195 CDD:290566 17/61 (28%)
leucine-rich repeat 137..160 CDD:275380 5/24 (21%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
LRR_8 184..243 CDD:290566 19/58 (33%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
LRR_8 232..289 CDD:290566 18/60 (30%)
leucine-rich repeat 233..256 CDD:275380 8/26 (31%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
LRR_8 280..339 CDD:290566 18/64 (28%)
leucine-rich repeat 281..304 CDD:275380 5/28 (18%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
fmodbXP_001338027.1 LRRNT 61..95 CDD:214470 1/33 (3%)
LRR_8 91..153 CDD:290566 13/61 (21%)
leucine-rich repeat 94..116 CDD:275380 3/21 (14%)
leucine-rich repeat 117..142 CDD:275380 5/24 (21%)
LRR_RI 136..345 CDD:238064 67/228 (29%)
LRR_8 141..198 CDD:290566 18/59 (31%)
leucine-rich repeat 143..163 CDD:275380 5/22 (23%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..210 CDD:275380 7/22 (32%)
LRR_8 210..266 CDD:290566 20/62 (32%)
leucine-rich repeat 211..231 CDD:275380 8/26 (31%)
leucine-rich repeat 232..255 CDD:275380 8/22 (36%)
leucine-rich repeat 256..280 CDD:275380 5/28 (18%)
leucine-rich repeat 281..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..321 CDD:275380 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.