Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025243.1 | Gene: | fmoda / 791822 | ZFINID: | ZDB-GENE-041008-23 | Length: | 342 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 78/272 - (28%) |
---|---|---|---|
Similarity: | 129/272 - (47%) | Gaps: | 24/272 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 LSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGL 182
Fly 183 HRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQKLE 247
Fly 248 PFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHN-YVDKIYDESLDSLIALLQLDIS 311
Fly 312 FNLLTTLPDNLFHFNTQLEEIILANNKIEEI------SSQMMFNQNHLRYIKLSGNAI------S 364
Fly 365 DAAFLDRLSPSV 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
LRR_8 | 64..123 | CDD:290566 | 3/4 (75%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | |||
leucine-rich repeat | 89..112 | CDD:275380 | |||
leucine-rich repeat | 113..136 | CDD:275380 | 4/17 (24%) | ||
LRR_RI | 115..384 | CDD:238064 | 78/272 (29%) | ||
LRR_8 | 135..195 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 184..243 | CDD:290566 | 18/58 (31%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 232..289 | CDD:290566 | 14/56 (25%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 280..339 | CDD:290566 | 16/59 (27%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 4/23 (17%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 8/22 (36%) | ||
fmoda | NP_001025243.1 | LRRNT | 44..77 | CDD:214470 | |
leucine-rich repeat | 76..98 | CDD:275380 | 4/17 (24%) | ||
leucine-rich repeat | 99..143 | CDD:275380 | 14/43 (33%) | ||
leucine-rich repeat | 123..138 | CDD:275380 | 7/14 (50%) | ||
LRR_8 | 142..201 | CDD:290566 | 20/62 (32%) | ||
LRR_RI | <144..325 | CDD:238064 | 54/191 (28%) | ||
leucine-rich repeat | 144..167 | CDD:275380 | 8/25 (32%) | ||
leucine-rich repeat | 168..190 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 191..210 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 212..235 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 234..291 | CDD:290566 | 16/60 (27%) | ||
leucine-rich repeat | 236..260 | CDD:275380 | 4/23 (17%) | ||
leucine-rich repeat | 261..280 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 281..310 | CDD:275380 | 7/28 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |