DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and Lrg1

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_084072.1 Gene:Lrg1 / 76905 MGIID:1924155 Length:342 Species:Mus musculus


Alignment Length:310 Identity:89/310 - (28%)
Similarity:137/310 - (44%) Gaps:68/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLA---RLVHLNLSSNLLQKLEPF 249
            ||::.:.:..:...:.:....||.|.|..|   .||.||...||   ||..|:|:.|.|:.|.|.
Mouse    66 LSVEFSNLTQLPAAALQGCPGLRELHLSSN---RLQALSPELLAPVPRLRALDLTRNALRSLPPG 127

  Fly   250 VFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNL 314
            :||.:..|..|.|..|.:.:::.:.|.|||:|..|:::.|.:..:....|.||.||..||:.:||
Mouse   128 LFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNL 192

  Fly   315 LTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSGNAISDAA--------FLDR 371
            |.:||:.|.....:|:.:.|..|:::.:...::..|..||.:.|:.|.:...|        .||.
Mouse   193 LESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDM 257

  Fly   372 LSPSVNRFTLYVDLSSNRLKSL--NLSSLL--------------HFRYI---NLADNNWSCNWLV 417
            |           |||:|.|.|.  .|.:.|              |..:|   ||||   .|.|||
Mouse   258 L-----------DLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLAD---LCRWLV 308

  Fly   418 ANLVQKLPNSVNFARPWTVINNLSENTTNVEGIDCIEGGTNRSIILLDVS 467
            ||     .|.:           .|:|.|...|.:.::|..     ||||:
Mouse   309 AN-----RNKM-----------FSQNDTRCAGPEAMKGQR-----LLDVA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380
LRR_RI 115..384 CDD:238064 59/206 (29%)
LRR_8 135..195 CDD:290566 2/6 (33%)
leucine-rich repeat 137..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
LRR_8 184..243 CDD:290566 18/57 (32%)
leucine-rich repeat 185..208 CDD:275380 2/19 (11%)
leucine-rich repeat 209..232 CDD:275380 11/25 (44%)
LRR_8 232..289 CDD:290566 20/56 (36%)
leucine-rich repeat 233..256 CDD:275380 9/22 (41%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
LRR_8 280..339 CDD:290566 19/58 (33%)
leucine-rich repeat 281..304 CDD:275380 6/22 (27%)
leucine-rich repeat 305..328 CDD:275380 9/22 (41%)
Lrg1NP_084072.1 leucine-rich repeat 65..86 CDD:275380 2/19 (11%)
LRR_8 66..121 CDD:290566 18/57 (32%)
LRR_RI <74..294 CDD:238064 66/233 (28%)
leucine-rich repeat 87..110 CDD:275380 11/25 (44%)
LRR_8 109..169 CDD:290566 21/59 (36%)
leucine-rich repeat 111..134 CDD:275380 9/22 (41%)
leucine-rich repeat 135..158 CDD:275380 7/22 (32%)
leucine-rich repeat 159..182 CDD:275380 6/22 (27%)
LRR_8 162..217 CDD:290566 18/54 (33%)
leucine-rich repeat 183..206 CDD:275380 9/22 (41%)
LRR_8 205..265 CDD:290566 16/70 (23%)
leucine-rich repeat 207..230 CDD:275380 4/22 (18%)
leucine-rich repeat 231..254 CDD:275380 5/22 (23%)
leucine-rich repeat 255..278 CDD:275380 11/33 (33%)
LRRCT 292..338 CDD:214507 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.