| Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001165952.1 | Gene: | Aspn / 66695 | MGIID: | 1913945 | Length: | 373 | Species: | Mus musculus |
| Alignment Length: | 263 | Identity: | 72/263 - (27%) |
|---|---|---|---|
| Similarity: | 128/263 - (48%) | Gaps: | 21/263 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 138 QQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDS 202
Fly 203 FESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQK--LEPFVFS--KNFELQDLDLS 263
Fly 264 YNNITKLNKEALSGL-DSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNT 327
Fly 328 QLEEIILANNKIEEISSQMMFNQNHLRYIKLSGNAISDAAFLDRLSPSVNRF--TLY--VDLSSN 388
Fly 389 RLK 391 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
| LRR_8 | 64..123 | CDD:290566 | |||
| leucine-rich repeat | 65..88 | CDD:275380 | |||
| leucine-rich repeat | 89..112 | CDD:275380 | |||
| leucine-rich repeat | 113..136 | CDD:275380 | |||
| LRR_RI | 115..384 | CDD:238064 | 69/254 (27%) | ||
| LRR_8 | 135..195 | CDD:290566 | 21/56 (38%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 8/21 (38%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 184..243 | CDD:290566 | 17/58 (29%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 232..289 | CDD:290566 | 15/61 (25%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 8/26 (31%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 4/23 (17%) | ||
| LRR_8 | 280..339 | CDD:290566 | 14/58 (24%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 5/22 (23%) | ||
| Aspn | NP_001165952.1 | LRRNT | 68..97 | CDD:214470 | |
| leucine-rich repeat | 77..96 | CDD:275380 | |||
| LRR 1 | 96..117 | 6/18 (33%) | |||
| leucine-rich repeat | 97..120 | CDD:275380 | 8/21 (38%) | ||
| LRR_8 | 98..155 | CDD:290566 | 21/56 (38%) | ||
| LRR 2 | 120..141 | 8/20 (40%) | |||
| leucine-rich repeat | 121..144 | CDD:275380 | 8/22 (36%) | ||
| LRR_RI | <139..333 | CDD:238064 | 52/205 (25%) | ||
| LRR 3 | 144..166 | 7/24 (29%) | |||
| leucine-rich repeat | 145..165 | CDD:275380 | 6/19 (32%) | ||
| Interaction with TGFB1 | 159..205 | 12/48 (25%) | |||
| leucine-rich repeat | 166..189 | CDD:275380 | 6/22 (27%) | ||
| LRR 5 | 189..212 | 8/22 (36%) | |||
| leucine-rich repeat | 190..215 | CDD:275380 | 8/24 (33%) | ||
| LRR_8 | 234..294 | CDD:290566 | 14/59 (24%) | ||
| LRR 6 | 235..255 | 4/19 (21%) | |||
| leucine-rich repeat | 236..259 | CDD:275380 | 5/22 (23%) | ||
| LRR 7 | 259..280 | 5/20 (25%) | |||
| leucine-rich repeat | 260..283 | CDD:275380 | 5/22 (23%) | ||
| LRR 8 | 283..305 | 7/22 (32%) | |||
| LRR 9 | 306..327 | 6/21 (29%) | |||
| leucine-rich repeat | 307..331 | CDD:275380 | 8/24 (33%) | ||
| LRR 10 | 328..349 | 6/21 (29%) | |||
| leucine-rich repeat | 332..359 | CDD:275380 | 5/17 (29%) | ||
| LRR 11 | 350..373 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45712 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||