Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571788.2 | Gene: | aspn / 65228 | ZFINID: | ZDB-GENE-041105-7 | Length: | 370 | Species: | Danio rerio |
Alignment Length: | 408 | Identity: | 96/408 - (23%) |
---|---|---|---|
Similarity: | 153/408 - (37%) | Gaps: | 124/408 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 LLTSLTLSNC-TLPHVENGFFVRFDHLLHLELQHSG------------LSDLDDFSLNGLT---- 87
Fly 88 ----KLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRIS 148
Fly 149 QIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLR 213
Fly 214 LDQNLLSSLQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGL 278
Fly 279 D----------------------------SLERLNISHNYVDKIYDESLDSLIALLQLDISFNLL 315
Fly 316 TTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIK---LSGNAISDAAFLDRLSPSVN 377
Fly 378 RF--TLY--VDLSSNRLK 391 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | 7/23 (30%) |
LRR_8 | 64..123 | CDD:290566 | 12/78 (15%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | 7/42 (17%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 3/22 (14%) | ||
LRR_RI | 115..384 | CDD:238064 | 75/303 (25%) | ||
LRR_8 | 135..195 | CDD:290566 | 22/59 (37%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 184..243 | CDD:290566 | 11/58 (19%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 232..289 | CDD:290566 | 18/84 (21%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 10/50 (20%) | ||
LRR_8 | 280..339 | CDD:290566 | 17/58 (29%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 5/22 (23%) | ||
aspn | NP_571788.2 | LRRNT | 64..94 | CDD:214470 | 4/41 (10%) |
leucine-rich repeat | 74..93 | CDD:275380 | 4/30 (13%) | ||
leucine-rich repeat | 94..117 | CDD:275380 | 11/37 (30%) | ||
LRR_8 | 97..152 | CDD:290566 | 22/54 (41%) | ||
leucine-rich repeat | 118..141 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | <133..323 | CDD:238064 | 51/227 (22%) | ||
leucine-rich repeat | 142..162 | CDD:275380 | 6/35 (17%) | ||
LRR_8 | 162..243 | CDD:290566 | 21/97 (22%) | ||
leucine-rich repeat | 163..186 | CDD:275380 | 6/33 (18%) | ||
leucine-rich repeat | 187..212 | CDD:275380 | 10/30 (33%) | ||
leucine-rich repeat | 213..232 | CDD:275380 | 0/18 (0%) | ||
LRR_8 | 231..291 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 304..323 | CDD:275380 | 4/19 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |