DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and dcn

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_571772.1 Gene:dcn / 64698 ZFINID:ZDB-GENE-010102-1 Length:373 Species:Danio rerio


Alignment Length:371 Identity:91/371 - (24%)
Similarity:155/371 - (41%) Gaps:70/371 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTELLTSLTLSNC-TLPHVENGF--FVRFD------------------HLLHLELQ--------- 71
            |:..|:.|.:|.| .||..::||  ||..|                  |:..|.:.         
Zfish     2 KSACLSLLLVSVCWALPFRQSGFMDFVMEDEPASGDGPGPELPTTRKPHVERLPMMPEGPEVPFC 66

  Fly    72 ------HSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKS 130
                  |..::...|..|..:.:                  ..||.. |.|||.:|.::::....
Zfish    67 PFRCQCHLRVAQCSDLGLKTVPE------------------KIPLDT-TLLDLQNNKITEIKEND 112

  Fly   131 FEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRI 195
            |:....||.|.|..|:|:.|...:|..|.:|:.|||:.|.|..:..:..:.   |..|.:..|:|
Zfish   113 FKGLKGLQTLILVNNKITIIHAKAFSSLINLERLYLSKNLLKEVPANIPKS---LQELRIHENQI 174

  Fly   196 EFIEMDSFESNTHLRSLRLDQNLLSS--LQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQ 258
            ..|:..||....::..:.|..|.|||  :...:...|.|:.::.::...|..:...:.|..|||.
Zfish   175 NKIKKSSFAGMANVIVMELGSNPLSSSGVDNGAFADLKRVSYIRIADTNLTSIPKGLPSSLFELH 239

  Fly   259 DLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLF 323
               |..|.|||:..::|.||.:|.:|.:|||.:..:.:.||.::..|.:|.:..|.||.:|..|.
Zfish   240 ---LDGNKITKVTADSLKGLKNLSKLGLSHNEISVVENGSLANVPHLRELHLENNALTAVPAGLA 301

  Fly   324 HFNTQLEEIILANNKIEEISSQMM----FNQNHLRY--IKLSGNAI 363
            . :..::.|.|.:|||..:.::..    :|.....|  |.|..|.:
Zfish   302 D-HKYIQVIYLHSNKIAAVGTEDFCPPGYNTKKAMYSGISLFSNPV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 11/43 (26%)
LRR_8 64..123 CDD:290566 12/73 (16%)
leucine-rich repeat 65..88 CDD:275380 4/37 (11%)
leucine-rich repeat 89..112 CDD:275380 2/22 (9%)
leucine-rich repeat 113..136 CDD:275380 6/22 (27%)
LRR_RI 115..384 CDD:238064 71/257 (28%)
LRR_8 135..195 CDD:290566 18/59 (31%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
LRR_8 184..243 CDD:290566 14/60 (23%)
leucine-rich repeat 185..208 CDD:275380 7/22 (32%)
leucine-rich repeat 209..232 CDD:275380 6/24 (25%)
LRR_8 232..289 CDD:290566 17/56 (30%)
leucine-rich repeat 233..256 CDD:275380 2/22 (9%)
leucine-rich repeat 257..280 CDD:275380 9/22 (41%)
LRR_8 280..339 CDD:290566 17/58 (29%)
leucine-rich repeat 281..304 CDD:275380 7/22 (32%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)
dcnNP_571772.1 LRRNT 66..97 CDD:214470 5/49 (10%)
LRR_RI <70..174 CDD:238064 29/125 (23%)
leucine-rich repeat 74..94 CDD:275380 3/37 (8%)
leucine-rich repeat 95..118 CDD:275380 6/23 (26%)
LRR_8 96..153 CDD:290566 20/56 (36%)
leucine-rich repeat 119..142 CDD:275380 9/22 (41%)
leucine-rich repeat 143..163 CDD:275380 6/19 (32%)
LRR_8 162..224 CDD:290566 14/64 (22%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
leucine-rich repeat 188..213 CDD:275380 6/24 (25%)
leucine-rich repeat 214..234 CDD:275380 1/19 (5%)
LRR_RI <233..>326 CDD:238064 31/96 (32%)
LRR_8 233..293 CDD:290566 22/62 (35%)
leucine-rich repeat 235..258 CDD:275380 11/25 (44%)
leucine-rich repeat 259..282 CDD:275380 7/22 (32%)
leucine-rich repeat 306..325 CDD:275380 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.