Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571772.1 | Gene: | dcn / 64698 | ZFINID: | ZDB-GENE-010102-1 | Length: | 373 | Species: | Danio rerio |
Alignment Length: | 371 | Identity: | 91/371 - (24%) |
---|---|---|---|
Similarity: | 155/371 - (41%) | Gaps: | 70/371 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 KTELLTSLTLSNC-TLPHVENGF--FVRFD------------------HLLHLELQ--------- 71
Fly 72 ------HSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKS 130
Fly 131 FEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRI 195
Fly 196 EFIEMDSFESNTHLRSLRLDQNLLSS--LQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQ 258
Fly 259 DLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLF 323
Fly 324 HFNTQLEEIILANNKIEEISSQMM----FNQNHLRY--IKLSGNAI 363 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | 11/43 (26%) |
LRR_8 | 64..123 | CDD:290566 | 12/73 (16%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | 4/37 (11%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 6/22 (27%) | ||
LRR_RI | 115..384 | CDD:238064 | 71/257 (28%) | ||
LRR_8 | 135..195 | CDD:290566 | 18/59 (31%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 184..243 | CDD:290566 | 14/60 (23%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 6/24 (25%) | ||
LRR_8 | 232..289 | CDD:290566 | 17/56 (30%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 280..339 | CDD:290566 | 17/58 (29%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 7/22 (32%) | ||
dcn | NP_571772.1 | LRRNT | 66..97 | CDD:214470 | 5/49 (10%) |
LRR_RI | <70..174 | CDD:238064 | 29/125 (23%) | ||
leucine-rich repeat | 74..94 | CDD:275380 | 3/37 (8%) | ||
leucine-rich repeat | 95..118 | CDD:275380 | 6/23 (26%) | ||
LRR_8 | 96..153 | CDD:290566 | 20/56 (36%) | ||
leucine-rich repeat | 119..142 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 143..163 | CDD:275380 | 6/19 (32%) | ||
LRR_8 | 162..224 | CDD:290566 | 14/64 (22%) | ||
leucine-rich repeat | 164..187 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 188..213 | CDD:275380 | 6/24 (25%) | ||
leucine-rich repeat | 214..234 | CDD:275380 | 1/19 (5%) | ||
LRR_RI | <233..>326 | CDD:238064 | 31/96 (32%) | ||
LRR_8 | 233..293 | CDD:290566 | 22/62 (35%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 11/25 (44%) | ||
leucine-rich repeat | 259..282 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 306..325 | CDD:275380 | 5/18 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |