Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017208890.1 | Gene: | omd / 557913 | ZFINID: | ZDB-GENE-060503-756 | Length: | 401 | Species: | Danio rerio |
Alignment Length: | 238 | Identity: | 71/238 - (29%) |
---|---|---|---|
Similarity: | 113/238 - (47%) | Gaps: | 43/238 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 HLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSS--EPLGALTNLDLSHNMLSKL 126
Fly 127 SVKSFEQYPQ-----LQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQL--AHIDGSFFRGLHR 184
Fly 185 LSSLSLQHNRI--------EFIEMDSFESNT-------------HLRSLRLDQNLLSSLQFLSQR 228
Fly 229 GLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLN 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | 71/238 (30%) |
LRR_8 | 64..123 | CDD:290566 | 19/60 (32%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | 115..384 | CDD:238064 | 56/185 (30%) | ||
LRR_8 | 135..195 | CDD:290566 | 22/66 (33%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 9/24 (38%) | ||
LRR_8 | 184..243 | CDD:290566 | 20/79 (25%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 8/43 (19%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 232..289 | CDD:290566 | 15/40 (38%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 6/15 (40%) | ||
LRR_8 | 280..339 | CDD:290566 | |||
leucine-rich repeat | 281..304 | CDD:275380 | |||
leucine-rich repeat | 305..328 | CDD:275380 | |||
omd | XP_017208890.1 | LRRNT | 63..97 | CDD:214470 | 1/2 (50%) |
LRR_8 | 93..155 | CDD:290566 | 19/60 (32%) | ||
leucine-rich repeat | 95..118 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 119..144 | CDD:275380 | 7/24 (29%) | ||
LRR_RI | 123..344 | CDD:238064 | 64/209 (31%) | ||
leucine-rich repeat | 145..165 | CDD:275380 | 9/27 (33%) | ||
LRR_8 | 164..226 | CDD:290566 | 21/61 (34%) | ||
leucine-rich repeat | 166..189 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 190..215 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 216..236 | CDD:275380 | 3/19 (16%) | ||
leucine-rich repeat | 237..260 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 240..294 | CDD:290566 | 15/54 (28%) | ||
leucine-rich repeat | 261..283 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 282..344 | CDD:290566 | 15/41 (37%) | ||
leucine-rich repeat | 284..307 | CDD:275380 | 10/26 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |