DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and omd

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_017208890.1 Gene:omd / 557913 ZFINID:ZDB-GENE-060503-756 Length:401 Species:Danio rerio


Alignment Length:238 Identity:71/238 - (29%)
Similarity:113/238 - (47%) Gaps:43/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 HLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSS--EPLGALTNLDLSHNMLSKL 126
            |:.||.:||:.:.::........|.|:.::||:|.|.|.:....  :.|..||.|.|.||.|   
Zfish    94 HIRHLYIQHNDIEEITSKPFINATSLREINLSYNKLQSSKVDKDVFKRLKDLTQLHLEHNNL--- 155

  Fly   127 SVKSFEQYPQ-----LQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQL--AHIDGSFFRGLHR 184
                 |..|.     |::|.|.:|:||:|..|:...|:.|..|.|..|:|  |.|.|....|:..
Zfish   156 -----EDIPSPLPKTLKRLHLGFNKISKIAADATRELTKLTVLDLGSNRLTDASIKGKILSGMKS 215

  Fly   185 LSSLSLQHNRI--------EFIEMDSFESNT-------------HLRSLRLDQNLLSSLQFLSQR 228
            |..:.|.:|::        |.|:..|.|:|:             :|.|||:..|.|.|:.: :..
Zfish   216 LMQIILCNNKLKSMPADLPESIQQISLENNSIVSIPEGYFKKTPNLVSLRMPHNKLKSVAY-NAF 279

  Fly   229 GLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLN 271
            .|::|:.|:|..|.|.|  ||...:|  |:.|.|::|:...||
Zfish   280 NLSKLMELHLGHNQLSK--PFFVPRN--LEHLYLNHNDFKDLN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 71/238 (30%)
LRR_8 64..123 CDD:290566 19/60 (32%)
leucine-rich repeat 65..88 CDD:275380 4/22 (18%)
leucine-rich repeat 89..112 CDD:275380 7/24 (29%)
leucine-rich repeat 113..136 CDD:275380 8/22 (36%)
LRR_RI 115..384 CDD:238064 56/185 (30%)
LRR_8 135..195 CDD:290566 22/66 (33%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..184 CDD:275380 9/24 (38%)
LRR_8 184..243 CDD:290566 20/79 (25%)
leucine-rich repeat 185..208 CDD:275380 8/43 (19%)
leucine-rich repeat 209..232 CDD:275380 8/22 (36%)
LRR_8 232..289 CDD:290566 15/40 (38%)
leucine-rich repeat 233..256 CDD:275380 9/22 (41%)
leucine-rich repeat 257..280 CDD:275380 6/15 (40%)
LRR_8 280..339 CDD:290566
leucine-rich repeat 281..304 CDD:275380
leucine-rich repeat 305..328 CDD:275380
omdXP_017208890.1 LRRNT 63..97 CDD:214470 1/2 (50%)
LRR_8 93..155 CDD:290566 19/60 (32%)
leucine-rich repeat 95..118 CDD:275380 4/22 (18%)
leucine-rich repeat 119..144 CDD:275380 7/24 (29%)
LRR_RI 123..344 CDD:238064 64/209 (31%)
leucine-rich repeat 145..165 CDD:275380 9/27 (33%)
LRR_8 164..226 CDD:290566 21/61 (34%)
leucine-rich repeat 166..189 CDD:275380 9/22 (41%)
leucine-rich repeat 190..215 CDD:275380 9/24 (38%)
leucine-rich repeat 216..236 CDD:275380 3/19 (16%)
leucine-rich repeat 237..260 CDD:275380 4/22 (18%)
LRR_8 240..294 CDD:290566 15/54 (28%)
leucine-rich repeat 261..283 CDD:275380 8/22 (36%)
LRR_8 282..344 CDD:290566 15/41 (37%)
leucine-rich repeat 284..307 CDD:275380 10/26 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.