DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and zgc:113307

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001018560.1 Gene:zgc:113307 / 553753 ZFINID:ZDB-GENE-050522-29 Length:343 Species:Danio rerio


Alignment Length:307 Identity:86/307 - (28%)
Similarity:141/307 - (45%) Gaps:58/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 HSGLSDLDDFSLNGLT-KLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFEQYP 135
            |.||:.|.    :||. :||||.|..||::||.|                        ::|:...
Zfish    59 HRGLNQLP----SGLPFRLQYLFLQGNNITSLGS------------------------RAFDNTT 95

  Fly   136 QLQQLDLRYNRI--SQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFI 198
            .|:.|.|.:|.:  .|::|..|..|:.|.:|::|.|.|..:......|   |..|.|.:|.||.|
Zfish    96 YLRWLILDHNELLSEQLDNVLFSSLTRLVNLFINHNNLTKVPAGLPSG---LKQLRLAYNHIEKI 157

  Fly   199 EMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNF--ELQDLD 261
            ....|::...|..:.|..|.|.:::....:||..|..|:||.|.|.     .|.|:.  .:|.|.
Zfish   158 SEGDFQNLDSLTLILLQGNRLKTIEEGDFKGLGALNLLDLSHNFLD-----TFPKHLPPSVQQLY 217

  Fly   262 LSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLD----SLIALLQLDISFNLLTTLPDNL 322
            ||.|::|.|::.:|.....|..|.:.||   |:.:|.||    :|.:|::||:|:|.||.:|.  
Zfish   218 LSNNSLTGLSENSLHAFSGLRYLRLGHN---KLRNERLDPGAFNLTSLVELDLSYNRLTEIPS-- 277

  Fly   323 FHFNTQLEEIILANNKIEEISSQMM------FNQNHLRYIKLSGNAI 363
              ....|:.:.|..|.|:|.:....      .:.:.::.::|.||.:
Zfish   278 --VPITLQYLYLEVNHIQEFNVSSFCRTVGPTSYSRMKILRLDGNKL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 16/51 (31%)
leucine-rich repeat 65..88 CDD:275380 6/16 (38%)
leucine-rich repeat 89..112 CDD:275380 10/22 (45%)
leucine-rich repeat 113..136 CDD:275380 1/22 (5%)
LRR_RI 115..384 CDD:238064 70/263 (27%)
LRR_8 135..195 CDD:290566 18/61 (30%)
leucine-rich repeat 137..160 CDD:275380 8/24 (33%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
LRR_8 184..243 CDD:290566 19/58 (33%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..232 CDD:275380 6/22 (27%)
LRR_8 232..289 CDD:290566 18/58 (31%)
leucine-rich repeat 233..256 CDD:275380 8/24 (33%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
LRR_8 280..339 CDD:290566 20/62 (32%)
leucine-rich repeat 281..304 CDD:275380 9/26 (35%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
zgc:113307NP_001018560.1 LRRNT 41..70 CDD:214470 5/14 (36%)
leucine-rich repeat 56..72 CDD:275380 6/16 (38%)
LRR_RI <60..274 CDD:238064 75/252 (30%)
LRR_8 72..133 CDD:290566 23/84 (27%)
leucine-rich repeat 73..96 CDD:275380 11/46 (24%)
leucine-rich repeat 97..122 CDD:275380 8/24 (33%)
leucine-rich repeat 123..146 CDD:275380 7/25 (28%)
LRR_8 142..200 CDD:290566 19/60 (32%)
leucine-rich repeat 147..167 CDD:275380 7/19 (37%)
leucine-rich repeat 168..191 CDD:275380 6/22 (27%)
leucine-rich repeat 192..212 CDD:275380 8/24 (33%)
LRR_8 211..272 CDD:290566 22/63 (35%)
leucine-rich repeat 213..236 CDD:275380 8/22 (36%)
leucine-rich repeat 237..261 CDD:275380 9/26 (35%)
leucine-rich repeat 282..311 CDD:275380 5/28 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.