| Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_060150.4 | Gene: | ASPN / 54829 | HGNCID: | 14872 | Length: | 379 | Species: | Homo sapiens |
| Alignment Length: | 280 | Identity: | 75/280 - (26%) |
|---|---|---|---|
| Similarity: | 123/280 - (43%) | Gaps: | 55/280 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 138 QQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDS 202
Fly 203 FESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQK--LEPFVFS------------- 252
Fly 253 -----KNF--ELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDI 310
Fly 311 SFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSGNAISDAAFLDRLSPS 375
Fly 376 VNRF--TLY--VDLSSNRLK 391 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
| LRR_8 | 64..123 | CDD:290566 | |||
| leucine-rich repeat | 65..88 | CDD:275380 | |||
| leucine-rich repeat | 89..112 | CDD:275380 | |||
| leucine-rich repeat | 113..136 | CDD:275380 | |||
| LRR_RI | 115..384 | CDD:238064 | 72/271 (27%) | ||
| LRR_8 | 135..195 | CDD:290566 | 22/56 (39%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 9/21 (43%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 184..243 | CDD:290566 | 17/58 (29%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 232..289 | CDD:290566 | 19/78 (24%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 9/44 (20%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 280..339 | CDD:290566 | 13/58 (22%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 4/22 (18%) | ||
| ASPN | NP_060150.4 | LRRNT | 73..103 | CDD:214470 | |
| leucine-rich repeat | 83..102 | CDD:275380 | |||
| leucine-rich repeat | 103..126 | CDD:275380 | 9/21 (43%) | ||
| LRR_8 | 104..161 | CDD:290566 | 22/56 (39%) | ||
| leucine-rich repeat | 127..150 | CDD:275380 | 8/22 (36%) | ||
| LRR_RI | <142..339 | CDD:238064 | 54/225 (24%) | ||
| leucine-rich repeat | 151..171 | CDD:275380 | 6/19 (32%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 196..221 | CDD:275380 | 8/24 (33%) | ||
| LRR_8 | 240..300 | CDD:290566 | 20/83 (24%) | ||
| leucine-rich repeat | 242..265 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 266..289 | CDD:275380 | 8/46 (17%) | ||
| leucine-rich repeat | 313..332 | CDD:275380 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45712 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||