DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and lum

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001011006.1 Gene:lum / 496415 XenbaseID:XB-GENE-1004934 Length:353 Species:Xenopus tropicalis


Alignment Length:312 Identity:81/312 - (25%)
Similarity:139/312 - (44%) Gaps:64/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PLGALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRIS--QIENDSFDGLSHLKHLYLNGNQL 171
            |.| :..|.|..||:..:...:|:...:|:.|.|.:|:::  :|:.::|..|.||..||::.|.|
 Frog    78 PAG-IQYLYLQSNMIEAIEEDAFKNVTELKWLILDHNQLTNGKIKKNAFSSLKHLVKLYISFNNL 141

  Fly   172 AHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQ-RGLARLVH 235
            ..:.|...:   .:..|.:.:|:|..|..:..|...:|..:.|..|.|........ :||.:|.:
 Frog   142 TELVGPLPK---TMDDLRVTNNKISKITPNILEGLENLTHIHLQYNALKEDSISGAFKGLKQLEY 203

  Fly   236 LNLSSNLLQK----LEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYD 296
            |:||.|.|.|    |.|.:.:..|:       .|.|..:..|...|..:|:.|.:|:|   |:.|
 Frog   204 LDLSFNELTKLPKGLPPSITTLYFD-------NNKIANIPDEFFQGFKALQYLRLSNN---KLKD 258

  Fly   297 ESLD----SLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQN------ 351
            ..:.    ::.:|::||:|||.|.::|    ..|..||.:.|..|||::      ||.|      
 Frog   259 GGVPGNAFNISSLVELDLSFNELGSIP----AVNEGLENLYLQVNKIQK------FNLNSFCKII 313

  Fly   352 ------HLRYIKLSGNAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSLNLSS 397
                  .:|:::|.||.||                 .|||..:....|.::|
 Frog   314 GPLEYSKIRHLRLDGNNIS-----------------RVDLPQDMYSCLRVAS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 5/13 (38%)
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380 1/2 (50%)
leucine-rich repeat 113..136 CDD:275380 5/22 (23%)
LRR_RI 115..384 CDD:238064 74/291 (25%)
LRR_8 135..195 CDD:290566 16/61 (26%)
leucine-rich repeat 137..160 CDD:275380 7/24 (29%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
LRR_8 184..243 CDD:290566 16/59 (27%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..232 CDD:275380 6/23 (26%)
LRR_8 232..289 CDD:290566 17/60 (28%)
leucine-rich repeat 233..256 CDD:275380 9/26 (35%)
leucine-rich repeat 257..280 CDD:275380 4/22 (18%)
LRR_8 280..339 CDD:290566 19/62 (31%)
leucine-rich repeat 281..304 CDD:275380 6/26 (23%)
leucine-rich repeat 305..328 CDD:275380 9/22 (41%)
lumNP_001011006.1 PRK15370 <56..>256 CDD:185268 50/191 (26%)
leucine-rich repeat 81..104 CDD:275380 5/22 (23%)
leucine-rich repeat 105..130 CDD:275380 7/24 (29%)
leucine-rich repeat 131..151 CDD:275380 6/22 (27%)
leucine-rich repeat 152..175 CDD:275380 5/22 (23%)
leucine-rich repeat 176..200 CDD:275380 6/23 (26%)
leucine-rich repeat 201..221 CDD:275380 8/19 (42%)
leucine-rich repeat 222..245 CDD:275380 5/29 (17%)
PLN03150 <235..>307 CDD:178695 25/84 (30%)
leucine-rich repeat 246..270 CDD:275380 6/26 (23%)
leucine-rich repeat 271..294 CDD:275380 11/26 (42%)
leucine-rich repeat 295..320 CDD:275380 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.