Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005005.1 | Gene: | OMD / 4958 | HGNCID: | 8134 | Length: | 421 | Species: | Homo sapiens |
Alignment Length: | 311 | Identity: | 84/311 - (27%) |
---|---|---|---|
Similarity: | 140/311 - (45%) | Gaps: | 47/311 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 LGALTNLDLSHNMLSKL-----SVKSFEQYP-QLQQLDLRYNRISQIENDSFDGLSHLKHLYLNG 168
Fly 169 NQL--AHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLA 231
Fly 232 RLVHLNLSSNLLQK--LEPFVFSKNFELQDLDLSYNNITKLNKEALSGL-DSLERLNISHNYVDK 293
Fly 294 IYDESLDSLIALLQLDISFNLLTTLPDNL-------------------FHFNTQLEEIILANNKI 339
Fly 340 EEISSQMM------FNQNHLRYIKLSGNAISD--AAFLDRLSPSVNRFTLY 382 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
LRR_8 | 64..123 | CDD:290566 | 3/12 (25%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | |||
leucine-rich repeat | 89..112 | CDD:275380 | 1/1 (100%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 4/28 (14%) | ||
LRR_RI | 115..384 | CDD:238064 | 82/306 (27%) | ||
LRR_8 | 135..195 | CDD:290566 | 23/62 (37%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 184..243 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 232..289 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 8/24 (33%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 6/23 (26%) | ||
LRR_8 | 280..339 | CDD:290566 | 20/77 (26%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 8/41 (20%) | ||
OMD | NP_005005.1 | NEL | <68..>305 | CDD:330839 | 68/243 (28%) |
LRR 1 | 92..113 | 8/20 (40%) | |||
leucine-rich repeat | 94..116 | CDD:275380 | 8/21 (38%) | ||
LRR 2 | 116..129 | 5/12 (42%) | |||
leucine-rich repeat | 117..142 | CDD:275380 | 8/24 (33%) | ||
LRR 3 | 142..164 | 7/24 (29%) | |||
leucine-rich repeat | 143..163 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 164..187 | CDD:275380 | 9/22 (41%) | ||
LRR 4 | 165..184 | 6/18 (33%) | |||
LRR 5 | 187..210 | 7/22 (32%) | |||
leucine-rich repeat | 188..213 | CDD:275380 | 8/24 (33%) | ||
LRR 6 | 213..233 | 6/23 (26%) | |||
leucine-rich repeat | 214..234 | CDD:275380 | 6/23 (26%) | ||
LRR 7 | 234..255 | 5/20 (25%) | |||
leucine-rich repeat | 235..258 | CDD:275380 | 6/22 (27%) | ||
LRR 8 | 258..280 | 7/21 (33%) | |||
leucine-rich repeat | 259..281 | CDD:275380 | 7/21 (33%) | ||
LRR 9 | 281..294 | 0/12 (0%) | |||
leucine-rich repeat | 282..301 | CDD:275380 | 1/18 (6%) | ||
LRR 10 | 301..321 | 7/19 (37%) | |||
LRR 11 | 331..353 | 5/21 (24%) | |||
leucine-rich repeat | 332..356 | CDD:275380 | 4/23 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 382..421 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |