DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and bgna

DIOPT Version :10

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001002227.1 Gene:bgna / 431774 ZFINID:ZDB-GENE-040704-74 Length:369 Species:Danio rerio


Alignment Length:233 Identity:67/233 - (28%)
Similarity:108/233 - (46%) Gaps:20/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFE 204
            |||:.|||::|....|.|||:|..|.|..||::.|....|..|.||..|.:.||.     :.|..
Zfish    96 LDLQSNRITEIREGDFKGLSNLYALVLRYNQISKIHPKAFLPLKRLQKLYISHNL-----LTSMP 155

  Fly   205 SN--THLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQK--LEPFVFSKNFELQDLDLSYN 265
            .|  :.|..||:..|.:..:...|..||..:..:.:..|.||.  .||..| ...:|..|.:|..
Zfish   156 KNLPSSLVELRIHDNRIKKVPAFSFSGLHNMHVIEMGRNPLQNSGFEPGAF-MGLKLNYLRISEA 219

  Fly   266 NITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLE 330
            .:|.:.|: |.|  ||..|::.:|.:..|....|.....|.:|.:..|.:..:......:.|.|.
Zfish   220 KLTGVPKD-LPG--SLHELHLDNNQIQAIELVDLSQYTQLQRLGLGSNQIRHIEHGALSYLTNLR 281

  Fly   331 EIILANNKIEEISSQMMFNQNHLRYIK---LSGNAISD 365
            |:.|.||::..:.|.:    :|::|::   |..|.|::
Zfish   282 ELHLDNNRLPSVPSGL----SHMKYLQVVYLHSNNITN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 LRR 22..>338 CDD:443914 60/201 (30%)
leucine-rich repeat 41..64 CDD:275380
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380
leucine-rich repeat 137..160 CDD:275380 10/19 (53%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..208 CDD:275380 6/24 (25%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
leucine-rich repeat 233..256 CDD:275380 6/24 (25%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
leucine-rich repeat 281..304 CDD:275380 5/22 (23%)
leucine-rich repeat 305..328 CDD:275380 3/22 (14%)
bgnaNP_001002227.1 LRRNT 64..93 CDD:214470
leucine-rich repeat 72..92 CDD:275380
leucine-rich repeat 93..116 CDD:275380 10/19 (53%)
LRR <96..>292 CDD:443914 61/204 (30%)
leucine-rich repeat 117..140 CDD:275380 8/22 (36%)
leucine-rich repeat 141..161 CDD:275380 6/24 (25%)
leucine-rich repeat 162..185 CDD:275380 7/22 (32%)
leucine-rich repeat 186..209 CDD:275380 6/23 (26%)
leucine-rich repeat 211..231 CDD:275380 7/22 (32%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
leucine-rich repeat 256..279 CDD:275380 3/22 (14%)
LRR_8 278..343 CDD:404697 12/42 (29%)
leucine-rich repeat 303..330 CDD:275380 3/13 (23%)
leucine-rich repeat 331..356 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.