DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and bgna

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001002227.1 Gene:bgna / 431774 ZFINID:ZDB-GENE-040704-74 Length:369 Species:Danio rerio


Alignment Length:233 Identity:67/233 - (28%)
Similarity:108/233 - (46%) Gaps:20/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFE 204
            |||:.|||::|....|.|||:|..|.|..||::.|....|..|.||..|.:.||.     :.|..
Zfish    96 LDLQSNRITEIREGDFKGLSNLYALVLRYNQISKIHPKAFLPLKRLQKLYISHNL-----LTSMP 155

  Fly   205 SN--THLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQK--LEPFVFSKNFELQDLDLSYN 265
            .|  :.|..||:..|.:..:...|..||..:..:.:..|.||.  .||..| ...:|..|.:|..
Zfish   156 KNLPSSLVELRIHDNRIKKVPAFSFSGLHNMHVIEMGRNPLQNSGFEPGAF-MGLKLNYLRISEA 219

  Fly   266 NITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLE 330
            .:|.:.|: |.|  ||..|::.:|.:..|....|.....|.:|.:..|.:..:......:.|.|.
Zfish   220 KLTGVPKD-LPG--SLHELHLDNNQIQAIELVDLSQYTQLQRLGLGSNQIRHIEHGALSYLTNLR 281

  Fly   331 EIILANNKIEEISSQMMFNQNHLRYIK---LSGNAISD 365
            |:.|.||::..:.|.:    :|::|::   |..|.|::
Zfish   282 ELHLDNNRLPSVPSGL----SHMKYLQVVYLHSNNITN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380
LRR_RI 115..384 CDD:238064 67/233 (29%)
LRR_8 135..195 CDD:290566 24/54 (44%)
leucine-rich repeat 137..160 CDD:275380 10/19 (53%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
LRR_8 184..243 CDD:290566 15/60 (25%)
leucine-rich repeat 185..208 CDD:275380 6/24 (25%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
LRR_8 232..289 CDD:290566 16/58 (28%)
leucine-rich repeat 233..256 CDD:275380 6/24 (25%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
LRR_8 280..339 CDD:290566 15/58 (26%)
leucine-rich repeat 281..304 CDD:275380 5/22 (23%)
leucine-rich repeat 305..328 CDD:275380 3/22 (14%)
bgnaNP_001002227.1 LRRNT 64..93 CDD:214470
leucine-rich repeat 72..92 CDD:275380
leucine-rich repeat 93..116 CDD:275380 10/19 (53%)
LRR_RI 94..>323 CDD:238064 67/233 (29%)
LRR_8 96..151 CDD:290566 24/59 (41%)
leucine-rich repeat 117..140 CDD:275380 8/22 (36%)
leucine-rich repeat 141..161 CDD:275380 6/24 (25%)
LRR_8 160..217 CDD:290566 15/57 (26%)
leucine-rich repeat 162..185 CDD:275380 7/22 (32%)
leucine-rich repeat 186..209 CDD:275380 6/23 (26%)
leucine-rich repeat 211..231 CDD:275380 7/22 (32%)
LRR_8 231..290 CDD:290566 15/58 (26%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
leucine-rich repeat 256..279 CDD:275380 3/22 (14%)
LRR_8 278..343 CDD:290566 12/42 (29%)
leucine-rich repeat 303..330 CDD:275380 3/13 (23%)
leucine-rich repeat 331..356 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.