DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and lum

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001002059.1 Gene:lum / 415149 ZFINID:ZDB-GENE-040625-24 Length:344 Species:Danio rerio


Alignment Length:388 Identity:99/388 - (25%)
Similarity:166/388 - (42%) Gaps:103/388 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YLLPGSLLLLIFSFSPRLSCLQLSKCNNTEVTLIRKTELLTSLTLSNCT------LPHVENGFFV 60
            |.:|.:.|..:  .||  ||.|..:|.            :...|...|.      :|.|..|   
Zfish    26 YYIPSAPLEGV--SSP--SCAQECECP------------INFPTAMYCNERNLKFIPIVPTG--- 71

  Fly    61 RFDHLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSS--LRSWSSEPLGALTNLDLSHNML 123
                :.:|.||::.:.::.....:..|.|::|.|.:||::|  :::.:.:.||:|..|..|||.|
Zfish    72 ----IKYLYLQNNFIEEIKAGVFDNATDLRWLVLDNNNITSDKIQAGTIDKLGSLEKLLFSHNKL 132

  Fly   124 SK----LSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHR 184
            :|    || ||.::                              |.|.||:|.....:...|:..
Zfish   133 TKPPGSLS-KSLDE------------------------------LKLIGNKLTSFPANTLAGMEN 166

  Fly   185 LSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQKLEPF 249
            |:::.|..|::      :.||.|.                 :.:||..|:.|::|.|.|:||...
Zfish   167 LTTVHLSKNKL------TTESLTG-----------------AFKGLKSLILLDVSENKLKKLPSG 208

  Fly   250 VFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHN-YVDKIYDESLDSLIALLQLDISFN 313
            |.:   .|..|....|:|..:....|:.|..|:.|.|||| .||......:.::.:||:||:|||
Zfish   209 VPA---SLLMLYADNNDIDSIPNGYLAKLPLLQYLRISHNKLVDSGVPAGVFNVSSLLELDLSFN 270

  Fly   314 LLTTLPDNLFHFNTQLEEIILANNKIE--EISSQMMF----NQNHLRYIKLSGNAISDAAFLD 370
            .|.|:|:    .|..||.:.|..|:|.  |:::...|    |.:.||.::|.||.|:.::..|
Zfish   271 KLKTIPE----INESLEHLYLQVNEINKFELTNICRFSSPVNYSRLRTLRLDGNNITHSSMPD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 5/28 (18%)
LRR_8 64..123 CDD:290566 17/60 (28%)
leucine-rich repeat 65..88 CDD:275380 3/22 (14%)
leucine-rich repeat 89..112 CDD:275380 7/24 (29%)
leucine-rich repeat 113..136 CDD:275380 11/26 (42%)
LRR_RI 115..384 CDD:238064 72/267 (27%)
LRR_8 135..195 CDD:290566 9/59 (15%)
leucine-rich repeat 137..160 CDD:275380 0/22 (0%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
LRR_8 184..243 CDD:290566 12/58 (21%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..232 CDD:275380 2/22 (9%)
LRR_8 232..289 CDD:290566 18/56 (32%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
leucine-rich repeat 257..280 CDD:275380 6/22 (27%)
LRR_8 280..339 CDD:290566 23/59 (39%)
leucine-rich repeat 281..304 CDD:275380 8/23 (35%)
leucine-rich repeat 305..328 CDD:275380 11/22 (50%)
lumNP_001002059.1 LRRNT 41..68 CDD:279764 6/38 (16%)
LRR_RI 58..274 CDD:238064 70/279 (25%)
LRR_8 70..132 CDD:290566 18/68 (26%)
leucine-rich repeat 72..95 CDD:275380 3/22 (14%)
leucine-rich repeat 96..121 CDD:275380 7/24 (29%)
LRR_8 121..177 CDD:290566 20/86 (23%)
leucine-rich repeat 122..142 CDD:275380 9/20 (45%)
leucine-rich repeat 143..166 CDD:275380 6/52 (12%)
LRR_8 166..247 CDD:290566 28/106 (26%)
leucine-rich repeat 167..191 CDD:275380 8/46 (17%)
leucine-rich repeat 192..212 CDD:275380 8/22 (36%)
leucine-rich repeat 213..236 CDD:275380 6/22 (27%)
LRR_8 235..292 CDD:290566 23/60 (38%)
leucine-rich repeat 237..261 CDD:275380 8/23 (35%)
leucine-rich repeat 282..311 CDD:275380 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.