Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002336.1 | Gene: | LUM / 4060 | HGNCID: | 6724 | Length: | 338 | Species: | Homo sapiens |
Alignment Length: | 268 | Identity: | 78/268 - (29%) |
---|---|---|---|
Similarity: | 124/268 - (46%) | Gaps: | 49/268 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 EQYPQLQQLD-LRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRI 195
Fly 196 EFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDL 260
Fly 261 DLSYNNITKLNKEALSGLDSLERLNISHNYV-DKIYDESLDSLIALLQLDISFNLLTTLPDNLFH 324
Fly 325 FNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSGNAISDAAFLDRLSPSVNRFT----LYVDL 385
Fly 386 SSNRLKSL 393 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
LRR_8 | 64..123 | CDD:290566 | |||
leucine-rich repeat | 65..88 | CDD:275380 | |||
leucine-rich repeat | 89..112 | CDD:275380 | |||
leucine-rich repeat | 113..136 | CDD:275380 | 2/3 (67%) | ||
LRR_RI | 115..384 | CDD:238064 | 72/257 (28%) | ||
LRR_8 | 135..195 | CDD:290566 | 18/60 (30%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 2/23 (9%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 184..243 | CDD:290566 | 13/58 (22%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 3/22 (14%) | ||
LRR_8 | 232..289 | CDD:290566 | 18/56 (32%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 280..339 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 4/23 (17%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 9/22 (41%) | ||
LUM | NP_002336.1 | LRRNT | 37..71 | CDD:214470 | 6/32 (19%) |
LRR 1 | 67..88 | 10/20 (50%) | |||
inl_like_NEAT_1 | <68..>310 | CDD:411101 | 73/238 (31%) | ||
leucine-rich repeat | 68..91 | CDD:275380 | 10/22 (45%) | ||
LRR 2 | 91..114 | 7/36 (19%) | |||
leucine-rich repeat | 92..117 | CDD:275380 | 9/38 (24%) | ||
LRR 3 | 117..137 | 6/26 (23%) | |||
leucine-rich repeat | 118..138 | CDD:275380 | 6/26 (23%) | ||
LRR 4 | 138..159 | 11/26 (42%) | |||
leucine-rich repeat | 139..160 | CDD:275380 | 11/22 (50%) | ||
LRR 5 | 160..181 | 3/20 (15%) | |||
leucine-rich repeat | 161..185 | CDD:275380 | 4/23 (17%) | ||
LRR 6 | 185..205 | 9/22 (41%) | |||
leucine-rich repeat | 186..206 | CDD:275380 | 9/22 (41%) | ||
LRR 7 | 206..227 | 7/20 (35%) | |||
leucine-rich repeat | 207..230 | CDD:275380 | 7/22 (32%) | ||
LRR 8 | 230..253 | 9/28 (32%) | |||
leucine-rich repeat | 231..255 | CDD:275380 | 9/29 (31%) | ||
LRR 9 | 255..276 | 6/15 (40%) | |||
leucine-rich repeat | 276..305 | CDD:275380 | |||
LRR 10 | 277..296 | ||||
LRR 11 | 305..326 | ||||
leucine-rich repeat | 306..329 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |