| Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001013675.1 | Gene: | LRRC26 / 389816 | HGNCID: | 31409 | Length: | 334 | Species: | Homo sapiens |
| Alignment Length: | 196 | Identity: | 62/196 - (31%) |
|---|---|---|---|
| Similarity: | 90/196 - (45%) | Gaps: | 10/196 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 PGSLLLLIFSFSPRLSCLQLSKCNNTEVTLIRK--TELLTSLT--LSNC---TLPHVENGFFVRF 62
Fly 63 DHLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLS 127
Fly 128 VKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQH 192
Fly 193 N 193 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | 8/27 (30%) |
| LRR_8 | 64..123 | CDD:290566 | 22/58 (38%) | ||
| leucine-rich repeat | 65..88 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 89..112 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 113..136 | CDD:275380 | 9/22 (41%) | ||
| LRR_RI | 115..384 | CDD:238064 | 26/79 (33%) | ||
| LRR_8 | 135..195 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 184..243 | CDD:290566 | 4/10 (40%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 4/9 (44%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | |||
| LRR_8 | 232..289 | CDD:290566 | |||
| leucine-rich repeat | 233..256 | CDD:275380 | |||
| leucine-rich repeat | 257..280 | CDD:275380 | |||
| LRR_8 | 280..339 | CDD:290566 | |||
| leucine-rich repeat | 281..304 | CDD:275380 | |||
| leucine-rich repeat | 305..328 | CDD:275380 | |||
| LRRC26 | NP_001013675.1 | LRR 1 | 72..93 | 6/23 (26%) | |
| LRR 2 | 96..117 | 7/20 (35%) | |||
| LRR_RI | 97..>253 | CDD:238064 | 37/105 (35%) | ||
| LRR_8 | 97..155 | CDD:290566 | 23/57 (40%) | ||
| leucine-rich repeat | 97..120 | CDD:275380 | 8/22 (36%) | ||
| LRR 3 | 120..141 | 10/20 (50%) | |||
| leucine-rich repeat | 121..144 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 143..202 | CDD:290566 | 18/59 (31%) | ||
| LRR 4 | 144..167 | 6/22 (27%) | |||
| leucine-rich repeat | 145..168 | CDD:275380 | 7/22 (32%) | ||
| LRR 5 | 168..190 | 6/21 (29%) | |||
| leucine-rich repeat | 169..192 | CDD:275380 | 7/22 (32%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 298..334 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165141283 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||