DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and Con

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster


Alignment Length:311 Identity:81/311 - (26%)
Similarity:158/311 - (50%) Gaps:48/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQI 150
            |..|..:.:.::.:..::|::...|..|..:.|::|.:..|...:|..:.:|::|:|.:|:|.::
  Fly   182 LKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEM 246

  Fly   151 ENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLD 215
            :..:|..|...:.|:||.|.::.:....|..:.||:.|:|.||:|                    
  Fly   247 DRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQI-------------------- 291

  Fly   216 QNLLSSLQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDS 280
             |:|:|..|   |||..|..|.|:.|.|..:...||::.:.|.:|:|..|.|.::::.||.||::
  Fly   292 -NVLTSEIF---RGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNT 352

  Fly   281 LERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLP--------DNLFHFNTQLEEIILANN 337
            |:.||:.:|.:.||.:..|....|||.:::..|.|.||.        |||.:   ...|:::::|
  Fly   353 LKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVN---STSELLVSDN 414

  Fly   338 K-IEEISSQMMFN-QNHLRYIKLSGNAISD----------AAFLDRLSPSV 376
            | |.:...|.:|. :|..|:::|. :::.|          :.|:|.:.|::
  Fly   415 KFICDCRLQWIFELKNRTRHLQLR-DSLEDLHCTLQEPKLSHFVDPVPPTI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 7/36 (19%)
leucine-rich repeat 65..88 CDD:275380 1/1 (100%)
leucine-rich repeat 89..112 CDD:275380 3/22 (14%)
leucine-rich repeat 113..136 CDD:275380 5/22 (23%)
LRR_RI 115..384 CDD:238064 76/282 (27%)
LRR_8 135..195 CDD:290566 18/59 (31%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
LRR_8 184..243 CDD:290566 18/58 (31%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
LRR_8 232..289 CDD:290566 19/56 (34%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 9/22 (41%)
LRR_8 280..339 CDD:290566 20/67 (30%)
leucine-rich repeat 281..304 CDD:275380 7/22 (32%)
leucine-rich repeat 305..328 CDD:275380 9/30 (30%)
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 27/108 (25%)
LRR_8 183..243 CDD:290566 12/59 (20%)
leucine-rich repeat 185..208 CDD:275380 3/22 (14%)
leucine-rich repeat 209..232 CDD:275380 5/22 (23%)
LRR_RI <225..416 CDD:238064 62/217 (29%)
LRR_8 232..291 CDD:290566 18/58 (31%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 5/22 (23%)
leucine-rich repeat 281..304 CDD:275380 13/46 (28%)
LRR_8 304..363 CDD:290566 20/58 (34%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)
leucine-rich repeat 329..352 CDD:275380 9/22 (41%)
LRR_8 352..416 CDD:290566 19/66 (29%)
leucine-rich repeat 353..376 CDD:275380 7/22 (32%)
LRRCT 414..>450 CDD:214507 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.