| Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001014075.1 | Gene: | Lrrc26 / 311803 | RGDID: | 1308398 | Length: | 334 | Species: | Rattus norvegicus |
| Alignment Length: | 268 | Identity: | 68/268 - (25%) |
|---|---|---|---|
| Similarity: | 104/268 - (38%) | Gaps: | 69/268 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 99 LSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFEQYP--------------------QLQQLDLR 143
Fly 144 YNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTH 208
Fly 209 LRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKE 273
Fly 274 ALSGLDSLERLNISHN-------------YVDK-----IYDESLDSLIALLQLDISFNLLTTLPD 320
Fly 321 NLFHFNTQ 328 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
| LRR_8 | 64..123 | CDD:290566 | 8/23 (35%) | ||
| leucine-rich repeat | 65..88 | CDD:275380 | |||
| leucine-rich repeat | 89..112 | CDD:275380 | 5/12 (42%) | ||
| leucine-rich repeat | 113..136 | CDD:275380 | 3/42 (7%) | ||
| LRR_RI | 115..384 | CDD:238064 | 62/252 (25%) | ||
| LRR_8 | 135..195 | CDD:290566 | 20/79 (25%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 184..243 | CDD:290566 | 15/58 (26%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 232..289 | CDD:290566 | 15/56 (27%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 280..339 | CDD:290566 | 18/67 (27%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 6/40 (15%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 10/22 (45%) | ||
| Lrrc26 | NP_001014075.1 | LRR_8 | 76..135 | CDD:290566 | 19/58 (33%) |
| LRR 1 | 76..97 | 7/20 (35%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 6/22 (27%) | ||
| LRR 2 | 100..121 | 6/20 (30%) | |||
| leucine-rich repeat | 101..124 | CDD:275380 | 8/22 (36%) | ||
| LRR 3 | 124..145 | 6/23 (26%) | |||
| LRR_8 | 125..183 | CDD:290566 | 23/81 (28%) | ||
| LRR_4 | 125..164 | CDD:289563 | 17/62 (27%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 9/35 (26%) | ||
| LRR 4 | 148..169 | 10/31 (32%) | |||
| leucine-rich repeat | 149..172 | CDD:275380 | 10/33 (30%) | ||
| LRR 5 | 172..194 | 6/21 (29%) | |||
| leucine-rich repeat | 173..196 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 197..239 | CDD:275380 | 6/41 (15%) | ||
| TPKR_C2 | 205..258 | CDD:301599 | 14/55 (25%) | ||
| leucine-rich repeat | 240..259 | CDD:275380 | 10/21 (48%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 312..334 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166334955 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||