DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and Lrrc26

DIOPT Version :10

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001014075.1 Gene:Lrrc26 / 311803 RGDID:1308398 Length:334 Species:Rattus norvegicus


Alignment Length:268 Identity:68/268 - (25%)
Similarity:104/268 - (38%) Gaps:69/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFEQYP--------------------QLQQLDLR 143
            ||..|.|:.|.:|.    |.|.:.::.:..::....|                    |::.|.|.
  Rat    23 LSWRRVWTQEHIGT----DPSKSPVAPVCPEACSCSPGGKANCSALALPAVPAGLSWQVRSLLLD 83

  Fly   144 YNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTH 208
            .||:|.:...:|.....|.:|.|..|:|..:....|.||..|..|.|..|::|.:...:|   |.
  Rat    84 RNRVSTLPPGAFADAGALLYLVLRENRLRSVHARAFWGLGVLQRLDLSSNQLETLSPGTF---TP 145

  Fly   209 LRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKE 273
            ||          :|.|||           |:.|.|..|||.:......|:.|.|..|:::.|...
  Rat   146 LR----------ALSFLS-----------LAGNRLALLEPSILGPLPLLRVLSLQDNSLSALEAG 189

  Fly   274 ALSGLDSLERLNISHN-------------YVDK-----IYDESLDSLIALLQLDISFNLLTTLPD 320
            .|:.|.:|:.|.:..|             ::.|     ...|:|..:...||   :.||||..||
  Rat   190 LLNSLPALDVLRLHGNPWACSCALRPLCTWLRKHPRPTSETETLLCVSPKLQ---TLNLLTDFPD 251

  Fly   321 NLFHFNTQ 328
            |.|...||
  Rat   252 NAFKQCTQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 LRR 22..>338 CDD:443914 68/268 (25%)
leucine-rich repeat 41..64 CDD:275380
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380 5/12 (42%)
leucine-rich repeat 113..136 CDD:275380 3/42 (7%)
leucine-rich repeat 137..160 CDD:275380 6/22 (27%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..232 CDD:275380 6/22 (27%)
leucine-rich repeat 233..256 CDD:275380 6/22 (27%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
leucine-rich repeat 281..304 CDD:275380 6/40 (15%)
leucine-rich repeat 305..328 CDD:275380 10/22 (45%)
Lrrc26NP_001014075.1 LRR <76..>205 CDD:443914 43/152 (28%)
LRR 1 76..97 7/20 (35%)
leucine-rich repeat 77..100 CDD:275380 6/22 (27%)
LRR 2 100..121 6/20 (30%)
leucine-rich repeat 101..124 CDD:275380 8/22 (36%)
LRR 3 124..145 6/23 (26%)
leucine-rich repeat 125..148 CDD:275380 9/35 (26%)
LRR 4 148..169 10/31 (32%)
leucine-rich repeat 149..172 CDD:275380 10/33 (30%)
LRR 5 172..194 6/21 (29%)
leucine-rich repeat 173..196 CDD:275380 7/22 (32%)
PCC 178..>295 CDD:188093 23/85 (27%)
leucine-rich repeat 197..239 CDD:275380 6/41 (15%)
leucine-rich repeat 240..259 CDD:275380 10/21 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..334
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.