DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and Dcn

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_077043.1 Gene:Dcn / 29139 RGDID:61895 Length:354 Species:Rattus norvegicus


Alignment Length:287 Identity:80/287 - (27%)
Similarity:131/287 - (45%) Gaps:29/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIE 199
            |....|||:.|:|::|:..:|..|..|..|.|..|:::.|....|:.|.:|..|.|..|.::  |
  Rat    76 PDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLK--E 138

  Fly   200 MDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQK--LEPFVFSKNFELQDL-D 261
            :......| |:.|||..|.::.|:.....||.|::.:.|..|.|:.  :|      |..||.: .
  Rat   139 LPEKLPKT-LQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIE------NGALQGMKG 196

  Fly   262 LSYNNITKLNKEAL-SGL-DSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFH 324
            |.|..|:..|..|: .|| .|:..|::..|.:.|:...||..:..|.:|.:|||.:|.:.:....
  Rat   197 LGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLA 261

  Fly   325 FNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSGNAISDAAFLDRLSPSV-NRFTLY--VDLS 386
            ....|.|:.|.|||:..:.:.:. ...:::.:.|..|.||:....|...||. .|.|.|  |.|.
  Rat   262 NVPHLRELHLDNNKLLRVPAGLA-QHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLY 325

  Fly   387 SNRLKSLNLSSLLHFRYINLADNNWSC 413
            ||.:           ||..:..:.:.|
  Rat   326 SNPV-----------RYWQIHPHTFRC 341

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380