DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and Podnl1

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_213845.6 Gene:Podnl1 / 288907 RGDID:1307753 Length:582 Species:Rattus norvegicus


Alignment Length:438 Identity:121/438 - (27%)
Similarity:193/438 - (44%) Gaps:79/438 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIFSFSPRLSCLQL--SKCNNTEV--TLIRKTELLTSLTLSN-------CTLP------HVENGF 58
            |.|...|.|..:.|  ::..||.:  .....:|.:|:|:||:       .:||      |::|..
  Rat   170 LTFGEKPALRSVYLHNNRLRNTGLPPNTFHGSEAITTLSLSSNQLRYLPPSLPASLERLHLQNNL 234

  Fly    59 FVRF--------DHLLHLELQHSGLSD--LDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPL-GA 112
            ..:.        ..|..|.|||:.|:|  ||..:.:.|:.|:||.||||.|:::    .|.| |.
  Rat   235 ISKVPRGALSLQTQLRELYLQHNQLTDSGLDATTFSKLSSLEYLDLSHNQLATV----PEGLPGN 295

  Fly   113 LTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRI--SQIENDSFDGLSHLKHLYLNGNQLAHID 175
            ||.|.|..|.:..:......:...|:.|.|::|::  |.:...:...|..|..|:|.||:|..:.
  Rat   296 LTILHLGRNCIRHVEAIRLHKAKGLRYLLLQHNKLEASALPAGTLRPLRALHTLHLYGNRLERVP 360

  Fly   176 GSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFL--SQRGLARLVHLNL 238
            .:..|   .|.:|.:.|||:..:......|...|..|.|..|.|:|....  :.|.|..|..|:|
  Rat   361 PALPR---HLQALVMPHNRVAALGARDLVSARALTELNLAYNRLASAHVHPGAFRRLRALRSLDL 422

  Fly   239 SSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHN--YVDKIYDESLDS 301
            :.|.|.:|...:.:   .|:.|.|..|.:..|..|.|:||:.|..||::||  .|..|...:...
  Rat   423 AGNQLSRLPEGLPA---SLRSLRLQRNQLRTLEPEQLAGLNKLRELNLAHNRLRVGDIEPGAWHE 484

  Fly   302 LIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSGNAISDA 366
            |.||..||:|.|.|:.:|.:|   ...|||:.|..|:|..:..:...:..|||       |:|  
  Rat   485 LQALQVLDLSHNELSFVPPDL---PEALEELYLQANRISHVGPEAFLSTPHLR-------ALS-- 537

  Fly   367 AFLDRLSPSVNRFTLYVDLSSNRLKSLNLSS-----LLHFRYINLADN 409
                              |.:|||...::::     |.|.|.::.|:|
  Rat   538 ------------------LRANRLHMTSIAAEAFRGLAHLRVVDTAEN 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 8/43 (19%)
LRR_8 64..123 CDD:290566 26/61 (43%)
leucine-rich repeat 65..88 CDD:275380 10/24 (42%)
leucine-rich repeat 89..112 CDD:275380 10/23 (43%)
leucine-rich repeat 113..136 CDD:275380 5/22 (23%)
LRR_RI 115..384 CDD:238064 73/274 (27%)
LRR_8 135..195 CDD:290566 17/61 (28%)
leucine-rich repeat 137..160 CDD:275380 6/24 (25%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
LRR_8 184..243 CDD:290566 18/60 (30%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..232 CDD:275380 8/24 (33%)
LRR_8 232..289 CDD:290566 18/56 (32%)
leucine-rich repeat 233..256 CDD:275380 6/22 (27%)
leucine-rich repeat 257..280 CDD:275380 9/22 (41%)
LRR_8 280..339 CDD:290566 22/60 (37%)
leucine-rich repeat 281..304 CDD:275380 8/24 (33%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
Podnl1XP_213845.6 leucine-rich repeat 64..82 CDD:275380
leucine-rich repeat 83..106 CDD:275380
LRR_8 84..143 CDD:290566
leucine-rich repeat 107..132 CDD:275380
leucine-rich repeat 133..177 CDD:275380 2/6 (33%)
LRR_8 152..214 CDD:290566 12/43 (28%)
LRR_RI 175..451 CDD:238064 77/285 (27%)
leucine-rich repeat 178..203 CDD:275380 4/24 (17%)
leucine-rich repeat 204..224 CDD:275380 6/19 (32%)
LRR_8 224..285 CDD:290566 19/60 (32%)
leucine-rich repeat 225..248 CDD:275380 2/22 (9%)
leucine-rich repeat 249..274 CDD:275380 10/24 (42%)
leucine-rich repeat 275..319 CDD:275380 16/47 (34%)
LRR_8 295..356 CDD:290566 16/60 (27%)
leucine-rich repeat 298..317 CDD:275380 3/18 (17%)
leucine-rich repeat 320..345 CDD:275380 6/24 (25%)
leucine-rich repeat 346..390 CDD:275380 13/46 (28%)
LRR_8 365..427 CDD:290566 19/64 (30%)
leucine-rich repeat 391..416 CDD:275380 8/24 (33%)
leucine-rich repeat 417..440 CDD:275380 7/25 (28%)
LRR_8 437..498 CDD:290566 23/60 (38%)
leucine-rich repeat 441..461 CDD:275380 8/19 (42%)
leucine-rich repeat 462..487 CDD:275380 8/24 (33%)
LRR_8 488..543 CDD:290566 21/84 (25%)
leucine-rich repeat 509..532 CDD:275380 6/22 (27%)
leucine-rich repeat 533..556 CDD:275380 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.