Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001272885.1 | Gene: | Podn / 242608 | MGIID: | 2674939 | Length: | 611 | Species: | Mus musculus |
Alignment Length: | 518 | Identity: | 120/518 - (23%) |
---|---|---|---|
Similarity: | 214/518 - (41%) | Gaps: | 130/518 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 LTLSNCTLPHVENGFFVRFDHLLHLELQHSGLSD--LDDFSLNGLTKLQYLSLSHNNLSSLRSWS 106
Fly 107 SEPLGALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQ--IENDSFDGLSHLKHLYLNGN 169
Fly 170 QLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNL-------------LSS 221
Fly 222 LQF--LSQRGLAR--------LVHLNLSSNLLQKLEPFVFS--KNFE------------------ 256
Fly 257 ---------------------------LQDLDLSYNNITKLNKEALSGLDSLERLNISHNYV--D 292
Fly 293 KIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIK 357
Fly 358 LSGNAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSLNLSSLLHFRYINLADNNWSCNWLVANLVQ 422
Fly 423 KLPNSVNFA-----RPWTVINNLSENTTNVEGI----------DCIEGGTNR--SIILLDVSG 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | 5/19 (26%) |
LRR_8 | 64..123 | CDD:290566 | 18/60 (30%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | 115..384 | CDD:238064 | 79/342 (23%) | ||
LRR_8 | 135..195 | CDD:290566 | 16/61 (26%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 5/24 (21%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 184..243 | CDD:290566 | 24/81 (30%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 12/37 (32%) | ||
LRR_8 | 232..289 | CDD:290566 | 21/111 (19%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 280..339 | CDD:290566 | 18/60 (30%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 10/22 (45%) | ||
Podn | NP_001272885.1 | PRK15370 | <71..>309 | CDD:185268 | 59/212 (28%) |
leucine-rich repeat | 80..97 | CDD:275380 | |||
LRR 1 | 98..119 | 4/16 (25%) | |||
leucine-rich repeat | 101..122 | CDD:275380 | 5/19 (26%) | ||
PLN00113 | 119..>583 | CDD:215061 | 116/501 (23%) | ||
LRR 2 | 122..145 | 6/22 (27%) | |||
leucine-rich repeat | 123..148 | CDD:275380 | 7/24 (29%) | ||
LRR 3 | 148..169 | 6/23 (26%) | |||
leucine-rich repeat | 149..193 | CDD:275380 | 14/46 (30%) | ||
LRR 4 | 170..190 | 6/19 (32%) | |||
LRR 5 | 193..213 | 3/19 (16%) | |||
leucine-rich repeat | 194..219 | CDD:275380 | 5/24 (21%) | ||
LRR 6 | 219..239 | 5/19 (26%) | |||
leucine-rich repeat | 220..240 | CDD:275380 | 5/19 (26%) | ||
LRR 7 | 240..261 | 7/23 (30%) | |||
leucine-rich repeat | 241..264 | CDD:275380 | 7/25 (28%) | ||
LRR 8 | 264..284 | 5/19 (26%) | |||
leucine-rich repeat | 265..290 | CDD:275380 | 6/24 (25%) | ||
LRR 9 | 290..311 | 6/20 (30%) | |||
leucine-rich repeat | 291..311 | CDD:275380 | 5/19 (26%) | ||
leucine-rich repeat | 312..335 | CDD:275380 | 8/22 (36%) | ||
LRR 10 | 312..332 | 8/19 (42%) | |||
LRR 11 | 335..358 | 2/22 (9%) | |||
leucine-rich repeat | 336..361 | CDD:275380 | 1/24 (4%) | ||
LRR 12 | 361..382 | 0/20 (0%) | |||
LRR 13 | 383..403 | 5/19 (26%) | |||
LRR 14 | 406..427 | 6/20 (30%) | |||
leucine-rich repeat | 407..503 | CDD:275380 | 29/107 (27%) | ||
LRR 15 | 432..453 | 10/23 (43%) | |||
LRR 16 | 477..490 | 5/12 (42%) | |||
LRR 17 | 503..523 | 4/38 (11%) | |||
leucine-rich repeat | 504..524 | CDD:275380 | 5/38 (13%) | ||
LRR 18 | 524..545 | 3/20 (15%) | |||
leucine-rich repeat | 525..548 | CDD:275380 | 3/22 (14%) | ||
LRR 19 | 548..569 | 4/20 (20%) | |||
leucine-rich repeat | 549..572 | CDD:275380 | 3/22 (14%) | ||
LRR 20 | 574..583 | 3/9 (33%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 585..611 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |