DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and FLRT1

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001371395.1 Gene:FLRT1 / 23769 HGNCID:3760 Length:674 Species:Homo sapiens


Alignment Length:567 Identity:131/567 - (23%)
Similarity:203/567 - (35%) Gaps:212/567 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LLTSLT--LSNCTLPHV---ENGFFVRFD-----------------HLLHLELQHSGL------- 75
            |:..||  :.:.|.|.|   :|||....|                 :|.:.::.::|:       
Human    41 LIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTK 105

  Fly    76 ----------SDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKS 130
                      :|||:|.:|....|:.|.|..||:.:                ::.:.|:::    
Human   106 VNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRT----------------IARDSLARI---- 150

  Fly   131 FEQYPQLQQLDLRYNRIS--QIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGL-HRLSSLSLQH 192
                |.|::|.|..|.:|  .||.|:|.....||.|:|:.|.|:.|..    || |.|..|.|..
Human   151 ----PLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPS----GLPHTLEELRLDD 207

  Fly   193 NRIEFIEMDSFESNTHLRSLRLDQNLL----------SSLQFLSQRGLAR----LVHLNLSSNLL 243
            |||..|.:.:|:....||.|.||.|||          |.||.|::..|.|    ...|||.|..|
Human   208 NRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHL 272

  Fly   244 QKLEPFVFSKNFELQDLDLS---YNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIAL 305
            |||         .|||..:|   ||.:.|:.:        |||                      
Human   273 QKL---------YLQDNAISHIPYNTLAKMRE--------LER---------------------- 298

  Fly   306 LQLDISFNLLTTLPDNLFHFNTQLEEIILANN--------------------------------- 337
              ||:|.|.|||||..||.....|.:::|.||                                 
Human   299 --LDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPE 361

  Fly   338 -----KIEEISSQM--MFNQNHLRYIKLSGNAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSLNL 395
                 .|::|:|:|  .|.......:..:....:.:......:|..:.|||.......||...|:
Human   362 KVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNI 426

  Fly   396 -----------SSLLHFRYINLADN---NWSCNWLVANLVQKLPNSVNFARPW------TVINNL 440
                       :..:|.:.:. ||:   .|...         ||.| :|...|      ..:.::
Human   427 DYPMATGDGAKTLAIHVKALT-ADSIRITWKAT---------LPAS-SFRLSWLRLGHSPAVGSI 480

  Fly   441 SENTTNVEGIDCIEGGTNRSIILLDVSGVPQPKSDNCDCVVAYDETN 487
            :|  |.|:|        :::..||...   :|||....|:|..:.:|
Human   481 TE--TLVQG--------DKTEYLLTAL---EPKSTYIICMVTMETSN 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 9/44 (20%)
LRR_8 64..123 CDD:290566 12/75 (16%)
leucine-rich repeat 65..88 CDD:275380 7/39 (18%)
leucine-rich repeat 89..112 CDD:275380 5/22 (23%)
leucine-rich repeat 113..136 CDD:275380 1/22 (5%)
LRR_RI 115..384 CDD:238064 85/328 (26%)
LRR_8 135..195 CDD:290566 24/62 (39%)
leucine-rich repeat 137..160 CDD:275380 9/24 (38%)
leucine-rich repeat 161..184 CDD:275380 9/23 (39%)
LRR_8 184..243 CDD:290566 26/72 (36%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..232 CDD:275380 13/32 (41%)
LRR_8 232..289 CDD:290566 19/63 (30%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
leucine-rich repeat 257..280 CDD:275380 7/25 (28%)
LRR_8 280..339 CDD:290566 18/96 (19%)
leucine-rich repeat 281..304 CDD:275380 3/22 (14%)
leucine-rich repeat 305..328 CDD:275380 11/22 (50%)
FLRT1NP_001371395.1 PRK15370 <58..>329 CDD:185268 91/339 (27%)
leucine-rich repeat 108..128 CDD:275380 5/19 (26%)
leucine-rich repeat 129..152 CDD:275380 6/46 (13%)
leucine-rich repeat 153..178 CDD:275380 9/24 (38%)
leucine-rich repeat 179..199 CDD:275380 9/23 (39%)
leucine-rich repeat 200..223 CDD:275380 8/22 (36%)
leucine-rich repeat 224..249 CDD:275380 10/24 (42%)
leucine-rich repeat 250..271 CDD:275380 7/20 (35%)
leucine-rich repeat 272..295 CDD:275380 11/31 (35%)
leucine-rich repeat 296..319 CDD:275380 14/46 (30%)
PCC 300..>406 CDD:188093 19/105 (18%)
FN3 441..505 CDD:214495 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.