Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_666229.1 | Gene: | Lrrc26 / 227618 | MGIID: | 2385129 | Length: | 331 | Species: | Mus musculus |
Alignment Length: | 225 | Identity: | 65/225 - (28%) |
---|---|---|---|
Similarity: | 89/225 - (39%) | Gaps: | 39/225 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 SWSSEPLGALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNG 168
Fly 169 NQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARL 233
Fly 234 VHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDES 298
Fly 299 LDSLIALLQLDISFNLLTTLPDNLFHFNTQ 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
LRR_8 | 64..123 | CDD:290566 | 6/18 (33%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | |||
leucine-rich repeat | 89..112 | CDD:275380 | 2/7 (29%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | 115..384 | CDD:238064 | 63/214 (29%) | ||
LRR_8 | 135..195 | CDD:290566 | 24/59 (41%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 184..243 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 232..289 | CDD:290566 | 10/56 (18%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 280..339 | CDD:290566 | 12/49 (24%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 8/22 (36%) | ||
Lrrc26 | NP_666229.1 | LRR_8 | 72..131 | CDD:290566 | 21/64 (33%) |
LRR 1 | 72..93 | 7/26 (27%) | |||
leucine-rich repeat | 73..96 | CDD:275380 | 7/22 (32%) | ||
LRR 2 | 96..117 | 8/20 (40%) | |||
leucine-rich repeat | 97..120 | CDD:275380 | 10/22 (45%) | ||
LRR | 118..141 | CDD:197688 | 8/22 (36%) | ||
LRR 3 | 120..141 | 7/20 (35%) | |||
LRR_8 | 121..179 | CDD:290566 | 21/57 (37%) | ||
leucine-rich repeat | 121..144 | CDD:275380 | 8/22 (36%) | ||
LRR 4 | 144..165 | 8/20 (40%) | |||
leucine-rich repeat | 145..168 | CDD:275380 | 8/22 (36%) | ||
LRR 5 | 168..191 | 7/22 (32%) | |||
LRR_4 | 169..204 | CDD:289563 | 12/42 (29%) | ||
leucine-rich repeat | 169..192 | CDD:275380 | 8/22 (36%) | ||
TPKR_C2 | 201..244 | CDD:301599 | 13/75 (17%) | ||
leucine-rich repeat | 236..255 | CDD:275380 | 8/21 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 310..331 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167831224 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |