DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and iglr-3

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001293349.1 Gene:iglr-3 / 171771 WormBaseID:WBGene00021353 Length:488 Species:Caenorhabditis elegans


Alignment Length:391 Identity:90/391 - (23%)
Similarity:151/391 - (38%) Gaps:114/391 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 LHRLSSLSLQHNRIEFIEMDSFESN-THLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQK 245
            |..:.||||.:|.|  ..:.:|.|. ..|:||||||..|..|.|.:.....:|..|::|.|.|.|
 Worm    48 LPNVLSLSLSNNSI--FRITTFPSEYRRLQSLRLDQCQLEKLDFDALSVFEQLRELDVSRNSLSK 110

  Fly   246 LEPFVFSKNF-ELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESL---------- 299
            |   :..:|. .|:.|:|::|..|.:  ..:|.|:||..:::|||.:..:....|          
 Worm   111 L---IIPRNLASLRVLNLAFNAFTYV--PDMSHLESLRLVDLSHNRLISVRPRMLPFNLEVVRLA 170

  Fly   300 ----------DSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKI------EEI------ 342
                      ..|..|.:||::||.| ....:|:||.|..|::.|.::.:      .|:      
 Worm   171 ANRFQHLSPWPFLHKLQELDVTFNDL-ECDCSLWHFVTWAEKLALFDSTMLPCRRPSELRKSPID 234

  Fly   343 ---------------SSQMMFNQNHLR------------YIKLSGNAISDAAFLDRLSPSVNRFT 380
                           |:.:..:..|:.            |.:.:|..||.......||.| .:..
 Worm   235 GKTVCGPTVVTSSPESAVVSLDDAHVMCCTALATPSPQLYWQFNGKNISSGLSQKHLSES-GKLE 298

  Fly   381 LYVDLSSNRLKSLNLSSLLHFRY---INLADNNWSCNWLVANLVQKLPNSVNFAR------PWTV 436
            ..:::...|||.:.       :|   .:||..|.|..:.|..  .|:|..:|.|.      .:|:
 Worm   299 FCLEIPKVRLKDMG-------KYKCVASLAGLNSSKEFHVER--DKIPIVLNSAEGIMIYCQFTI 354

  Fly   437 INNLSENTTNVEGIDCI-------EGG-------TNRSIILLDVSGVPQPKSDNCD-CVVAYDET 486
            ...:        |:.|:       .||       .||..:...|..:|.   |:|: |.|..|:.
 Worm   355 CTFI--------GVCCVISCCVLRTGGGGRGKTRPNREYLHTKVLEIPH---DSCEYCEVDDDDV 408

  Fly   487 N 487
            :
 Worm   409 D 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380
LRR_RI 115..384 CDD:238064 63/262 (24%)
LRR_8 135..195 CDD:290566 6/12 (50%)
leucine-rich repeat 137..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380 1/1 (100%)
LRR_8 184..243 CDD:290566 22/59 (37%)
leucine-rich repeat 185..208 CDD:275380 8/23 (35%)
leucine-rich repeat 209..232 CDD:275380 10/22 (45%)
LRR_8 232..289 CDD:290566 18/57 (32%)
leucine-rich repeat 233..256 CDD:275380 8/23 (35%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
LRR_8 280..339 CDD:290566 19/78 (24%)
leucine-rich repeat 281..304 CDD:275380 6/42 (14%)
leucine-rich repeat 305..328 CDD:275380 9/22 (41%)
iglr-3NP_001293349.1 LRR <47..>196 CDD:227223 46/154 (30%)
leucine-rich repeat 51..73 CDD:275380 8/23 (35%)
leucine-rich repeat 74..97 CDD:275380 10/22 (45%)
leucine-rich repeat 98..119 CDD:275380 8/23 (35%)
leucine-rich repeat 120..141 CDD:275380 7/22 (32%)
leucine-rich repeat 142..163 CDD:275380 5/20 (25%)
leucine-rich repeat 164..185 CDD:275380 1/20 (5%)
Ig_3 243..319 CDD:372822 13/83 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.