Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032464.1 | Gene: | Kera / 16545 | MGIID: | 1202398 | Length: | 351 | Species: | Mus musculus |
Alignment Length: | 275 | Identity: | 71/275 - (25%) |
---|---|---|---|
Similarity: | 128/275 - (46%) | Gaps: | 33/275 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 116 LDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQ--IENDSFDGLSHLKHLYLNGNQLAHIDGSF 178
Fly 179 FRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLL--SSLQFLSQRGLARLVHLNLSSN 241
Fly 242 LLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDS----L 302
Fly 303 IALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMM------------FNQNHLRY 355
Fly 356 IKLSGNAISDAAFLD 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
LRR_8 | 64..123 | CDD:290566 | 3/6 (50%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | |||
leucine-rich repeat | 89..112 | CDD:275380 | |||
leucine-rich repeat | 113..136 | CDD:275380 | 6/19 (32%) | ||
LRR_RI | 115..384 | CDD:238064 | 71/275 (26%) | ||
LRR_8 | 135..195 | CDD:290566 | 18/61 (30%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 184..243 | CDD:290566 | 17/60 (28%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 232..289 | CDD:290566 | 11/56 (20%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 280..339 | CDD:290566 | 18/62 (29%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 7/26 (27%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 8/22 (36%) | ||
Kera | NP_032464.1 | PRK15370 | 16..>298 | CDD:185268 | 64/233 (27%) |
LRR 1 | 73..94 | 5/16 (31%) | |||
leucine-rich repeat | 74..97 | CDD:275380 | 6/19 (32%) | ||
LRR 2 | 97..118 | 7/20 (35%) | |||
leucine-rich repeat | 98..123 | CDD:275380 | 7/24 (29%) | ||
LRR 3 | 123..143 | 5/19 (26%) | |||
leucine-rich repeat | 124..144 | CDD:275380 | 5/19 (26%) | ||
LRR 4 | 144..165 | 6/23 (26%) | |||
leucine-rich repeat | 145..168 | CDD:275380 | 6/25 (24%) | ||
LRR 5 | 168..181 | 5/12 (42%) | |||
leucine-rich repeat | 169..194 | CDD:275380 | 8/24 (33%) | ||
LRR 6 | 194..214 | 6/19 (32%) | |||
leucine-rich repeat | 195..218 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 215..236 | 4/23 (17%) | |||
leucine-rich repeat | 219..239 | CDD:275380 | 4/19 (21%) | ||
LRR 8 | 239..259 | 7/22 (32%) | |||
leucine-rich repeat | 240..265 | CDD:275380 | 7/27 (26%) | ||
LRR 9 | 264..283 | 7/22 (32%) | |||
LRR_8 | 268..331 | CDD:338972 | 17/66 (26%) | ||
LRR 10 | 284..305 | 5/20 (25%) | |||
leucine-rich repeat | 285..320 | CDD:275380 | 5/34 (15%) | ||
leucine-rich repeat | 321..342 | CDD:275380 | 7/18 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |