DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and Kera

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_032464.1 Gene:Kera / 16545 MGIID:1202398 Length:351 Species:Mus musculus


Alignment Length:275 Identity:71/275 - (25%)
Similarity:128/275 - (46%) Gaps:33/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQ--IENDSFDGLSHLKHLYLNGNQLAHIDGSF 178
            |.|.:|::..:..|.||...||:.::|..|:|:.  ||..:...|..|..|:|..|:|..:....
Mouse    77 LYLENNLIESIPEKPFENATQLRWINLNKNKITNYGIEKGALSQLKKLLFLFLEDNELEEVPSPL 141

  Fly   179 FRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLL--SSLQFLSQRGLARLVHLNLSSN 241
            .|.|.:   |.|..|::..|...:|.:..:|..|.|..|.|  ::.|..:.:||..|:.||::.|
Mouse   142 PRSLEQ---LQLARNKVSRIPQGTFSNLENLTLLDLQHNKLLDNAFQRDTFKGLKNLMQLNMAKN 203

  Fly   242 LLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDS----L 302
            .|:.:.|.:.:...:   |.|..|:|..:.:...:.:..:..|.::||   |:.|..|.|    :
Mouse   204 ALRNMPPRLPANTMQ---LFLDNNSIEGIPENYFNVIPKVAFLRLNHN---KLSDAGLPSRGFDV 262

  Fly   303 IALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMM------------FNQNHLRY 355
            .::|.|.:|:|.||..|    ..|..|:.:.|.:|||:.::..::            .:...|.|
Mouse   263 SSILDLQLSYNQLTNFP----RINANLQHLHLDHNKIKNVNMSVICPTTLRAEQDAFIHGPQLSY 323

  Fly   356 IKLSGNAISDAAFLD 370
            ::|.||.|.....:|
Mouse   324 LRLDGNEIKPPIPID 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 3/6 (50%)
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380 6/19 (32%)
LRR_RI 115..384 CDD:238064 71/275 (26%)
LRR_8 135..195 CDD:290566 18/61 (30%)
leucine-rich repeat 137..160 CDD:275380 7/24 (29%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
LRR_8 184..243 CDD:290566 17/60 (28%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..232 CDD:275380 8/24 (33%)
LRR_8 232..289 CDD:290566 11/56 (20%)
leucine-rich repeat 233..256 CDD:275380 6/22 (27%)
leucine-rich repeat 257..280 CDD:275380 4/22 (18%)
LRR_8 280..339 CDD:290566 18/62 (29%)
leucine-rich repeat 281..304 CDD:275380 7/26 (27%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
KeraNP_032464.1 PRK15370 16..>298 CDD:185268 64/233 (27%)
LRR 1 73..94 5/16 (31%)
leucine-rich repeat 74..97 CDD:275380 6/19 (32%)
LRR 2 97..118 7/20 (35%)
leucine-rich repeat 98..123 CDD:275380 7/24 (29%)
LRR 3 123..143 5/19 (26%)
leucine-rich repeat 124..144 CDD:275380 5/19 (26%)
LRR 4 144..165 6/23 (26%)
leucine-rich repeat 145..168 CDD:275380 6/25 (24%)
LRR 5 168..181 5/12 (42%)
leucine-rich repeat 169..194 CDD:275380 8/24 (33%)
LRR 6 194..214 6/19 (32%)
leucine-rich repeat 195..218 CDD:275380 6/22 (27%)
LRR 7 215..236 4/23 (17%)
leucine-rich repeat 219..239 CDD:275380 4/19 (21%)
LRR 8 239..259 7/22 (32%)
leucine-rich repeat 240..265 CDD:275380 7/27 (26%)
LRR 9 264..283 7/22 (32%)
LRR_8 268..331 CDD:338972 17/66 (26%)
LRR 10 284..305 5/20 (25%)
leucine-rich repeat 285..320 CDD:275380 5/34 (15%)
leucine-rich repeat 321..342 CDD:275380 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.