| Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_031715.1 | Gene: | Chad / 12643 | MGIID: | 1096866 | Length: | 358 | Species: | Mus musculus |
| Alignment Length: | 326 | Identity: | 88/326 - (26%) |
|---|---|---|---|
| Similarity: | 140/326 - (42%) | Gaps: | 64/326 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 117 DLSHNMLSKLSVKSFEQYPQLQQ----LDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGS 177
Fly 178 FFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRG----LARLVHLNL 238
Fly 239 SSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLI 303
Fly 304 ALLQLDISFNLLTTLPDNLFH-FNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSGNAISDAA 367
Fly 368 FLDRLSPSVNRFTLYVDLSSNRLKSL-------NLSSLLHFRYINLADNNWSC--------NWLV 417
Fly 418 A 418 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
| LRR_8 | 64..123 | CDD:290566 | 3/5 (60%) | ||
| leucine-rich repeat | 65..88 | CDD:275380 | |||
| leucine-rich repeat | 89..112 | CDD:275380 | |||
| leucine-rich repeat | 113..136 | CDD:275380 | 4/18 (22%) | ||
| LRR_RI | 115..384 | CDD:238064 | 72/275 (26%) | ||
| LRR_8 | 135..195 | CDD:290566 | 18/63 (29%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 5/26 (19%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 184..243 | CDD:290566 | 22/62 (35%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 10/26 (38%) | ||
| LRR_8 | 232..289 | CDD:290566 | 14/56 (25%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 280..339 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 9/23 (39%) | ||
| Chad | NP_031715.1 | LRRNT | 22..48 | CDD:279764 | 5/19 (26%) |
| LRR 1 | 51..72 | 5/20 (25%) | |||
| leucine-rich repeat | 52..75 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 74..134 | CDD:290566 | 20/59 (34%) | ||
| LRR 2 | 75..96 | 4/20 (20%) | |||
| leucine-rich repeat | 76..99 | CDD:275380 | 7/22 (32%) | ||
| LRR_RI | <89..281 | CDD:238064 | 64/222 (29%) | ||
| LRR 3 | 99..120 | 7/20 (35%) | |||
| leucine-rich repeat | 100..123 | CDD:275380 | 7/22 (32%) | ||
| LRR 4 | 123..144 | 9/24 (38%) | |||
| leucine-rich repeat | 124..147 | CDD:275380 | 10/26 (38%) | ||
| LRR_8 | 147..206 | CDD:290566 | 15/58 (26%) | ||
| LRR 5 | 147..168 | 6/20 (30%) | |||
| leucine-rich repeat | 148..171 | CDD:275380 | 6/22 (27%) | ||
| LRR 6 | 171..192 | 7/20 (35%) | |||
| leucine-rich repeat | 172..195 | CDD:275380 | 7/22 (32%) | ||
| LRR 7 | 195..216 | 3/20 (15%) | |||
| leucine-rich repeat | 196..219 | CDD:275380 | 4/22 (18%) | ||
| LRR 8 | 219..240 | 8/20 (40%) | |||
| LRR_8 | 220..279 | CDD:290566 | 23/85 (27%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 9/22 (41%) | ||
| LRR 9 | 244..265 | 10/47 (21%) | |||
| leucine-rich repeat | 245..268 | CDD:275380 | 11/49 (22%) | ||
| LRR 10 | 268..289 | 6/20 (30%) | |||
| leucine-rich repeat | 269..291 | CDD:275380 | 6/21 (29%) | ||
| LRRCT | 299..346 | CDD:214507 | 6/18 (33%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 322..358 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167831230 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||