DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and Prelp

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_473418.3 Gene:Prelp / 116847 MGIID:2151110 Length:378 Species:Mus musculus


Alignment Length:287 Identity:82/287 - (28%)
Similarity:130/287 - (45%) Gaps:39/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFR 180
            |.|.:|.:::|.::||:....|:.::|..|||.:::......|..|..||:..|||..:..:..|
Mouse   103 LYLQNNFITELPLESFQNATGLRWVNLDNNRIRKVDQRVLGKLPSLAFLYMEKNQLEEVPSALPR 167

  Fly   181 GLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQ--RGLARLVHLNLSSNLL 243
            .|.:   |.|..|.|..|....|....:|..|.|..|.||...|.:.  :||..|:.|||:.|:|
Mouse   168 NLEQ---LRLSQNLISRIPPGVFSKLENLLLLDLQHNRLSDGVFKADTFQGLKNLMQLNLAHNIL 229

  Fly   244 QKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLD----SLIA 304
            :|:.|.|..   .:..|.|..|.|..:.........:|..:.:::|   |:.|..|.    ::..
Mouse   230 RKMPPKVPQ---AIHQLYLDSNKIETIPNGYFKDFPNLAFIRMNYN---KLSDRGLPKNSFNISN 288

  Fly   305 LLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEIS---------------SQMMFNQNHLR 354
            ||.|.:|.|.::.:|    ..:.:||.:.|.||.||:|:               |..:.|..|||
Mouse   289 LLVLHLSHNKISNVP----AISNKLEHLYLNNNSIEKINGTQICPNNLVAFHDFSSDLENVPHLR 349

  Fly   355 YIKLSGNAISDAAFLD-----RLSPSV 376
            |::|.||.:.....||     ||..||
Mouse   350 YLRLDGNFLKPPIPLDLMMCFRLLQSV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 3/6 (50%)
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380 6/19 (32%)
LRR_RI 115..384 CDD:238064 82/287 (29%)
LRR_8 135..195 CDD:290566 17/59 (29%)
leucine-rich repeat 137..160 CDD:275380 6/22 (27%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
LRR_8 184..243 CDD:290566 20/60 (33%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..232 CDD:275380 9/24 (38%)
LRR_8 232..289 CDD:290566 14/56 (25%)
leucine-rich repeat 233..256 CDD:275380 9/22 (41%)
leucine-rich repeat 257..280 CDD:275380 4/22 (18%)
LRR_8 280..339 CDD:290566 16/62 (26%)
leucine-rich repeat 281..304 CDD:275380 5/26 (19%)
leucine-rich repeat 305..328 CDD:275380 6/22 (27%)
PrelpNP_473418.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..62
LRRNT 68..103 CDD:214470 82/287 (29%)
LRR 1 91..110 3/6 (50%)
leucine-rich repeat 100..123 CDD:275380 6/19 (32%)
LRR 2 111..134 6/22 (27%)
leucine-rich repeat 124..147 CDD:275380 6/22 (27%)
PRK15370 <129..>349 CDD:185268 63/232 (27%)
LRR 3 135..158 5/22 (23%)
leucine-rich repeat 148..168 CDD:275380 6/19 (32%)
LRR 4 159..179 5/22 (23%)
leucine-rich repeat 169..192 CDD:275380 7/25 (28%)
LRR 5 180..203 6/22 (27%)
leucine-rich repeat 193..218 CDD:275380 9/24 (38%)
LRR 6 204..229 9/24 (38%)
leucine-rich repeat 219..239 CDD:275380 9/22 (41%)
LRR 7 230..250 6/22 (27%)
leucine-rich repeat 240..263 CDD:275380 4/22 (18%)
LRR 8 251..274 2/25 (8%)
leucine-rich repeat 264..288 CDD:275380 5/26 (19%)
LRR 9 275..299 7/23 (30%)
LRR 10 300..319 6/22 (27%)
leucine-rich repeat 309..347 CDD:275380 10/37 (27%)
LRR 11 320..358 11/37 (30%)
LRR 12 359..378 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.