Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_473418.3 | Gene: | Prelp / 116847 | MGIID: | 2151110 | Length: | 378 | Species: | Mus musculus |
Alignment Length: | 287 | Identity: | 82/287 - (28%) |
---|---|---|---|
Similarity: | 130/287 - (45%) | Gaps: | 39/287 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 116 LDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFR 180
Fly 181 GLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQ--RGLARLVHLNLSSNLL 243
Fly 244 QKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLD----SLIA 304
Fly 305 LLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEIS---------------SQMMFNQNHLR 354
Fly 355 YIKLSGNAISDAAFLD-----RLSPSV 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
LRR_8 | 64..123 | CDD:290566 | 3/6 (50%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | |||
leucine-rich repeat | 89..112 | CDD:275380 | |||
leucine-rich repeat | 113..136 | CDD:275380 | 6/19 (32%) | ||
LRR_RI | 115..384 | CDD:238064 | 82/287 (29%) | ||
LRR_8 | 135..195 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 184..243 | CDD:290566 | 20/60 (33%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 9/24 (38%) | ||
LRR_8 | 232..289 | CDD:290566 | 14/56 (25%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 280..339 | CDD:290566 | 16/62 (26%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 5/26 (19%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 6/22 (27%) | ||
Prelp | NP_473418.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 22..62 | ||
LRRNT | 68..103 | CDD:214470 | 82/287 (29%) | ||
LRR 1 | 91..110 | 3/6 (50%) | |||
leucine-rich repeat | 100..123 | CDD:275380 | 6/19 (32%) | ||
LRR 2 | 111..134 | 6/22 (27%) | |||
leucine-rich repeat | 124..147 | CDD:275380 | 6/22 (27%) | ||
PRK15370 | <129..>349 | CDD:185268 | 63/232 (27%) | ||
LRR 3 | 135..158 | 5/22 (23%) | |||
leucine-rich repeat | 148..168 | CDD:275380 | 6/19 (32%) | ||
LRR 4 | 159..179 | 5/22 (23%) | |||
leucine-rich repeat | 169..192 | CDD:275380 | 7/25 (28%) | ||
LRR 5 | 180..203 | 6/22 (27%) | |||
leucine-rich repeat | 193..218 | CDD:275380 | 9/24 (38%) | ||
LRR 6 | 204..229 | 9/24 (38%) | |||
leucine-rich repeat | 219..239 | CDD:275380 | 9/22 (41%) | ||
LRR 7 | 230..250 | 6/22 (27%) | |||
leucine-rich repeat | 240..263 | CDD:275380 | 4/22 (18%) | ||
LRR 8 | 251..274 | 2/25 (8%) | |||
leucine-rich repeat | 264..288 | CDD:275380 | 5/26 (19%) | ||
LRR 9 | 275..299 | 7/23 (30%) | |||
LRR 10 | 300..319 | 6/22 (27%) | |||
leucine-rich repeat | 309..347 | CDD:275380 | 10/37 (27%) | ||
LRR 11 | 320..358 | 11/37 (30%) | |||
LRR 12 | 359..378 | 6/18 (33%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |