Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_443204.1 | Gene: | LRG1 / 116844 | HGNCID: | 29480 | Length: | 347 | Species: | Homo sapiens |
Alignment Length: | 335 | Identity: | 91/335 - (27%) |
---|---|---|---|
Similarity: | 138/335 - (41%) | Gaps: | 75/335 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 168 GNQLAHIDGSFFRGLHRLSSLSLQ--------------HNRIEFIEMDSFESN-----THLRSLR 213
Fly 214 LDQNLLSSL--QFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALS 276
Fly 277 GLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEE 341
Fly 342 ISSQMMFNQNHLRYIKLSGNAISDAAF--------LDRLSPSVNRFTLYVDLSSNRLKSLNLSSL 398
Fly 399 LHFRYINLADNNWSCNWLVANLVQKLPNSVNFA-RPWTVINNL---------------SENTTNV 447
Fly 448 EGIDCIEGGT 457 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
LRR_8 | 64..123 | CDD:290566 | |||
leucine-rich repeat | 65..88 | CDD:275380 | |||
leucine-rich repeat | 89..112 | CDD:275380 | |||
leucine-rich repeat | 113..136 | CDD:275380 | |||
LRR_RI | 115..384 | CDD:238064 | 72/244 (30%) | ||
LRR_8 | 135..195 | CDD:290566 | 11/40 (28%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | |||
leucine-rich repeat | 161..184 | CDD:275380 | 5/15 (33%) | ||
LRR_8 | 184..243 | CDD:290566 | 22/79 (28%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 8/41 (20%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 10/24 (42%) | ||
LRR_8 | 232..289 | CDD:290566 | 19/56 (34%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 280..339 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 9/22 (41%) | ||
LRG1 | NP_443204.1 | LRR_8 | 79..128 | CDD:290566 | 15/50 (30%) |
LRR_RI | <82..248 | CDD:238064 | 55/167 (33%) | ||
LRR 1 | 93..114 | 9/22 (41%) | |||
leucine-rich repeat | 94..117 | CDD:275380 | 10/24 (42%) | ||
LRR_8 | 116..176 | CDD:290566 | 20/59 (34%) | ||
LRR 2 | 117..138 | 8/20 (40%) | |||
leucine-rich repeat | 118..141 | CDD:275380 | 8/22 (36%) | ||
LRR 3 | 141..162 | 6/20 (30%) | |||
leucine-rich repeat | 142..165 | CDD:275380 | 8/22 (36%) | ||
LRR 4 | 165..186 | 6/20 (30%) | |||
leucine-rich repeat | 166..189 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 169..224 | CDD:290566 | 19/54 (35%) | ||
LRR 5 | 189..210 | 9/20 (45%) | |||
leucine-rich repeat | 190..213 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 213..272 | CDD:290566 | 21/74 (28%) | ||
LRR 6 | 213..234 | 6/20 (30%) | |||
leucine-rich repeat | 214..237 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 237..258 | 7/20 (35%) | |||
leucine-rich repeat | 238..261 | CDD:275380 | 7/22 (32%) | ||
LRR 8 | 261..282 | 9/36 (25%) | |||
leucine-rich repeat | 262..285 | CDD:275380 | 10/38 (26%) | ||
LRRCT | 299..346 | CDD:214507 | 10/41 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165141287 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |