DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and LRG1

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_443204.1 Gene:LRG1 / 116844 HGNCID:29480 Length:347 Species:Homo sapiens


Alignment Length:335 Identity:91/335 - (27%)
Similarity:138/335 - (41%) Gaps:75/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 GNQLAHIDGSFFRGLHRLSSLSLQ--------------HNRIEFIEMDSFESN-----THLRSLR 213
            |..|:..|...||..|. ||:|.|              |..:||..:....:|     :.|:.|.
Human    35 GVTLSPKDCQVFRSDHG-SSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELH 98

  Fly   214 LDQNLLSSL--QFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALS 276
            |..|.|.||  :||  |.:.:|..|:|:.|.|..|.|.:|..:..|..|.|..|.:..|....|.
Human    99 LSSNGLESLSPEFL--RPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLH 161

  Fly   277 GLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEE 341
            ||.:|..|::|.|.:.|:....|.:...|..||:..|.|.|||.:|.....|||.:.|..||::.
Human   162 GLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQV 226

  Fly   342 ISSQMMFNQNHLRYIKLSGNAISDAAF--------LDRLSPSVNRFTLYVDLSSNRLKSLNLSSL 398
            :...::..|..|||:.|:||.::..|.        ||.|           |||:|     :|:|:
Human   227 LGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDML-----------DLSNN-----SLASV 275

  Fly   399 LHFRYINLADNNWSCNWLVANLVQKLPNSVNFA-RPWTVINNL---------------SENTTNV 447
            ....:.:|...||.           :.:..:.: .||....||               |:|.|..
Human   276 PEGLWASLGQPNWD-----------MRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRC 329

  Fly   448 EGIDCIEGGT 457
            .|.:.::|.|
Human   330 AGPEAVKGQT 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380
LRR_RI 115..384 CDD:238064 72/244 (30%)
LRR_8 135..195 CDD:290566 11/40 (28%)
leucine-rich repeat 137..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380 5/15 (33%)
LRR_8 184..243 CDD:290566 22/79 (28%)
leucine-rich repeat 185..208 CDD:275380 8/41 (20%)
leucine-rich repeat 209..232 CDD:275380 10/24 (42%)
LRR_8 232..289 CDD:290566 19/56 (34%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
LRR_8 280..339 CDD:290566 20/58 (34%)
leucine-rich repeat 281..304 CDD:275380 6/22 (27%)
leucine-rich repeat 305..328 CDD:275380 9/22 (41%)
LRG1NP_443204.1 LRR_8 79..128 CDD:290566 15/50 (30%)
LRR_RI <82..248 CDD:238064 55/167 (33%)
LRR 1 93..114 9/22 (41%)
leucine-rich repeat 94..117 CDD:275380 10/24 (42%)
LRR_8 116..176 CDD:290566 20/59 (34%)
LRR 2 117..138 8/20 (40%)
leucine-rich repeat 118..141 CDD:275380 8/22 (36%)
LRR 3 141..162 6/20 (30%)
leucine-rich repeat 142..165 CDD:275380 8/22 (36%)
LRR 4 165..186 6/20 (30%)
leucine-rich repeat 166..189 CDD:275380 6/22 (27%)
LRR_8 169..224 CDD:290566 19/54 (35%)
LRR 5 189..210 9/20 (45%)
leucine-rich repeat 190..213 CDD:275380 9/22 (41%)
LRR_8 213..272 CDD:290566 21/74 (28%)
LRR 6 213..234 6/20 (30%)
leucine-rich repeat 214..237 CDD:275380 6/22 (27%)
LRR 7 237..258 7/20 (35%)
leucine-rich repeat 238..261 CDD:275380 7/22 (32%)
LRR 8 261..282 9/36 (25%)
leucine-rich repeat 262..285 CDD:275380 10/38 (26%)
LRRCT 299..346 CDD:214507 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.