| Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011522516.1 | Gene: | CHAD / 1101 | HGNCID: | 1909 | Length: | 440 | Species: | Homo sapiens |
| Alignment Length: | 327 | Identity: | 89/327 - (27%) |
|---|---|---|---|
| Similarity: | 142/327 - (43%) | Gaps: | 66/327 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 117 DLSHNMLSKLSVKSFEQYPQLQQ----LDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGS 177
Fly 178 FFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRG----LARLVHLNL 238
Fly 239 SSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLI 303
Fly 304 ALLQLDISFNLLTTLPDNLFH-FNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSGNAISDAA 367
Fly 368 FLDRLSPSVNRFTL-YVDLSSNRLKSL-------NLSSLLHFRYINLADNNWSC--------NWL 416
Fly 417 VA 418 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
| LRR_8 | 64..123 | CDD:290566 | 3/5 (60%) | ||
| leucine-rich repeat | 65..88 | CDD:275380 | |||
| leucine-rich repeat | 89..112 | CDD:275380 | |||
| leucine-rich repeat | 113..136 | CDD:275380 | 4/18 (22%) | ||
| LRR_RI | 115..384 | CDD:238064 | 74/276 (27%) | ||
| LRR_8 | 135..195 | CDD:290566 | 19/63 (30%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 5/26 (19%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 184..243 | CDD:290566 | 21/62 (34%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 9/26 (35%) | ||
| LRR_8 | 232..289 | CDD:290566 | 15/56 (27%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 280..339 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 9/23 (39%) | ||
| CHAD | XP_011522516.1 | LRRNT | 104..130 | CDD:279764 | 5/19 (26%) |
| leucine-rich repeat | 134..157 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 156..216 | CDD:290566 | 21/59 (36%) | ||
| leucine-rich repeat | 158..181 | CDD:275380 | 8/22 (36%) | ||
| LRR_RI | <171..363 | CDD:238064 | 65/223 (29%) | ||
| leucine-rich repeat | 182..205 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 204..264 | CDD:290566 | 21/63 (33%) | ||
| leucine-rich repeat | 206..229 | CDD:275380 | 9/26 (35%) | ||
| leucine-rich repeat | 230..253 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 254..277 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 278..301 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 302..361 | CDD:290566 | 24/86 (28%) | ||
| leucine-rich repeat | 302..325 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 10/50 (20%) | ||
| leucine-rich repeat | 351..373 | CDD:275380 | 7/21 (33%) | ||
| LRRCT | 381..428 | CDD:214507 | 6/18 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165141289 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||