DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and Chadl

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_038936217.1 Gene:Chadl / 100910434 RGDID:6504353 Length:747 Species:Rattus norvegicus


Alignment Length:698 Identity:148/698 - (21%)
Similarity:225/698 - (32%) Gaps:261/698 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLLLIFSFSPRLS-----CLQLSKCNN------------TEV-----TLIRKTEL--------- 40
            :||||:...||..:     |.|...|:|            |||     .|.::.:|         
  Rat    18 TLLLLMMFLSPAWNVAAQRCPQTCVCDNSRRHVTCQHQNLTEVPDTIPELTQRLDLQGNMLKVIP 82

  Fly    41 ---------LTSLTLSNCTLPHVENGFFVRFDHLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSH 96
                     ||.|.|.:|.:..|..|.|.....||.|.|..:.||.|...:|:||..|:.|.|..
  Rat    83 PAAFQDLPYLTHLDLQHCQVEQVAEGAFRGLGRLLFLNLASNRLSSLPQEALDGLGSLRRLELER 147

  Fly    97 NNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHL 161
            |.|..||..:...||:|..|:|:||.|..|...:|:...:.:.|.|.:|.:|.:..::..||..|
  Rat   148 NMLEELRPGTFGALGSLATLNLAHNALVYLPAMAFQGLMRTRWLQLSHNALSVLAPEALAGLPVL 212

  Fly   162 KHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLS 226
            :.|.|:.|:|..:.|:.......|:.|.|.||.:.:...:...:...||.|.||.   .|||.|.
  Rat   213 RRLSLHHNELQALPGAALSQARSLARLELGHNPLTYTGEEDGLALPGLRELALDH---GSLQALG 274

  Fly   227 QRGLA---RLVHLNLSSNLLQKLEPFV-------------------------------------- 250
            .|..|   ||..|:|..|.|..|.|..                                      
  Rat   275 PRAFAHCPRLHTLDLRGNQLTTLPPLQVPGQLRRLRLQGNPLWCACHARPLLEWLVRARVRSDGA 339

  Fly   251 ----------------------------------------------------------------- 250
                                                                             
  Rat   340 CRGPRRLRGETLDTLRPSDLRCPGDAAEDEDEDRPAGPRSPPRSLHEEARWATPCPPACVCVGET 404

  Fly   251 ----------------FSKNFELQD----------------------LDLSYNNITKLNKEALSG 277
                            |..:.:|.|                      |.|.:..|.:|...||:|
  Rat   405 RHSACDGRGLQAVPRGFPNDTQLLDLRRNHFPSVPRAAFPGLRHLVSLHLQHCGIAELEPGALAG 469

  Fly   278 LDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEI 342
            ||.|..|.:|:|.:..:...:|:....|..|.:..|....:|........:|..:.|.:|.::.:
  Rat   470 LDGLVYLYLSNNQLSGLSAAALEGAPNLGYLYLEHNRFLRIPGAALRALPRLFSLHLQDNAVDRL 534

  Fly   343 SSQMMFNQNHLRYIKLSGNAISDAAFLDRLSPSVNRFTLYVDLSSNR------------LKSLNL 395
            :...:.....||.:.||||.|:..: ...|.|:.....|::|.:..|            ||.|.|
  Rat   535 APGDLAGARALRGLYLSGNHITQVS-PGALGPARELEKLHLDRNQLRQVPTGALEGLPALKELQL 598

  Fly   396 S----SLLH---FR---------YINLAD-------------NNWSCNWLVANLVQKLPNSVNFA 431
            |    ..||   |:         ::|.:|             ......:|..|.:|.||     |
  Rat   599 SRNPFRALHDGAFQPVGRSLQQLFLNSSDLEQISPRAFSGLGKGLQGLYLQQNQLQSLP-----A 658

  Fly   432 RPWTVINNLSENTTNVEGIDCIEGGTNRSIILLDVSGVPQPKSDNCDC 479
            ..|            :.|::           |:|:||.|    .:|||
  Rat   659 PMW------------LSGLE-----------LIDLSGNP----FHCDC 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 8/22 (36%)
LRR_8 64..123 CDD:290566 24/58 (41%)
leucine-rich repeat 65..88 CDD:275380 10/22 (45%)
leucine-rich repeat 89..112 CDD:275380 8/22 (36%)
leucine-rich repeat 113..136 CDD:275380 8/22 (36%)
LRR_RI 115..384 CDD:238064 77/412 (19%)
LRR_8 135..195 CDD:290566 17/59 (29%)
leucine-rich repeat 137..160 CDD:275380 6/22 (27%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
LRR_8 184..243 CDD:290566 21/61 (34%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..232 CDD:275380 11/25 (44%)
LRR_8 232..289 CDD:290566 23/197 (12%)
leucine-rich repeat 233..256 CDD:275380 8/141 (6%)
leucine-rich repeat 257..280 CDD:275380 10/44 (23%)
LRR_8 280..339 CDD:290566 12/58 (21%)
leucine-rich repeat 281..304 CDD:275380 5/22 (23%)
leucine-rich repeat 305..328 CDD:275380 4/22 (18%)
ChadlXP_038936217.1 PLN00113 30..>555 CDD:215061 110/527 (21%)
leucine-rich repeat 48..66 CDD:275380 3/17 (18%)
leucine-rich repeat 68..91 CDD:275380 1/22 (5%)
leucine-rich repeat 92..115 CDD:275380 8/22 (36%)
leucine-rich repeat 116..139 CDD:275380 10/22 (45%)
leucine-rich repeat 140..163 CDD:275380 8/22 (36%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..211 CDD:275380 6/22 (27%)
leucine-rich repeat 212..235 CDD:275380 6/22 (27%)
leucine-rich repeat 236..259 CDD:275380 5/22 (23%)
leucine-rich repeat 260..283 CDD:275380 11/25 (44%)
leucine-rich repeat 306..345 CDD:275380 0/38 (0%)
leucine-rich repeat 425..448 CDD:275380 2/22 (9%)
PPP1R42 446..603 CDD:411060 38/157 (24%)
leucine-rich repeat 449..472 CDD:275380 8/22 (36%)
leucine-rich repeat 473..496 CDD:275380 5/22 (23%)
leucine-rich repeat 497..520 CDD:275380 4/22 (18%)
leucine-rich repeat 521..544 CDD:275380 3/22 (14%)
leucine-rich repeat 545..568 CDD:275380 9/23 (39%)
leucine-rich repeat 569..592 CDD:275380 3/22 (14%)
LRR_8 591..653 CDD:404697 12/61 (20%)
leucine-rich repeat 593..617 CDD:275380 8/23 (35%)
leucine-rich repeat 618..641 CDD:275380 2/22 (9%)
leucine-rich repeat 643..665 CDD:275380 7/38 (18%)
leucine-rich repeat 666..677 CDD:275378 5/25 (20%)
LRRCT 673..721 CDD:214507 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.