DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and lrrtm2

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001338621.1 Gene:lrrtm2 / 100538061 ZFINID:ZDB-GENE-080327-8 Length:542 Species:Danio rerio


Alignment Length:379 Identity:98/379 - (25%)
Similarity:163/379 - (43%) Gaps:54/379 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFE 204
            |.||:|.||::.:|.|.|.:.|..|:|:.||:..:....|:||::|..|:|..|||..:...:|.
Zfish    66 LSLRHNSISELSSDQFFGFTQLTWLHLDHNQITTVHEDAFQGLYKLKDLNLSSNRITKLPNTTFI 130

  Fly   205 SNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITK 269
            ...:|:.|.|..|.:::|:.....||.:|..|:|.||.|:......|.....|:.|.||.|.:..
Zfish   131 HLINLQILDLSFNQMTALEPELFHGLRKLQILHLRSNSLRTTPVRAFWDCRSLEYLGLSNNRLRS 195

  Fly   270 LNKEALSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIIL 334
            |.:...:||..|..|::.||::.||.......|:||..|.:.:|.:..|...:....|.||::.|
Zfish   196 LARNGFAGLIKLRELHLEHNHLTKINLAHFPRLVALQFLYLQWNKINNLTSTMEWKWTTLEKLDL 260

  Fly   335 ANNKIEEISSQMMFNQNHLRYIKLSGNAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSLNLSSLL 399
            ..|:|..:..::......|:.:.|..|.:|:   ||  |.:::.:           ||||:    
Zfish   261 TGNEIRVLIPEVFETLPSLKILLLDNNKLSN---LD--SQTMDMW-----------KSLNV---- 305

  Fly   400 HFRYINLADNNWSCNWLVANLVQKLPNSVNFARPW--TVINNLSENTTNVEGIDCIEG------- 455
                |.|:.|.|.|...:.||...|.   .|...|  :::....|.....|.:|.:.|       
Zfish   306 ----IGLSSNLWECTKRICNLATWLS---TFKGRWEHSILCYSPEYAQGEEILDAVYGFQLCQNF 363

  Fly   456 -------GTNRSIILLDVS-----GVPQPKSD------NCDCVVAYDETNPSPP 491
                   .|:...:|.|::     .:..|..|      ....:|....|...||
Zfish   364 SAPVVLTSTSTEAMLPDITSSLFGNMQTPTQDFYAEDFGSFTIVTTTTTTTQPP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380
LRR_RI 115..384 CDD:238064 71/243 (29%)
LRR_8 135..195 CDD:290566 21/54 (39%)
leucine-rich repeat 137..160 CDD:275380 9/19 (47%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
LRR_8 184..243 CDD:290566 19/58 (33%)
leucine-rich repeat 185..208 CDD:275380 7/22 (32%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
LRR_8 232..289 CDD:290566 17/56 (30%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
LRR_8 280..339 CDD:290566 17/58 (29%)
leucine-rich repeat 281..304 CDD:275380 7/22 (32%)
leucine-rich repeat 305..328 CDD:275380 4/22 (18%)
lrrtm2NP_001338621.1 LRR_8 66..121 CDD:316378 21/54 (39%)
leucine-rich repeat 66..86 CDD:275380 9/19 (47%)
leucine-rich repeat 87..110 CDD:275380 8/22 (36%)
LRR <108..>295 CDD:227223 54/191 (28%)
leucine-rich repeat 111..134 CDD:275380 7/22 (32%)
leucine-rich repeat 135..158 CDD:275380 7/22 (32%)
leucine-rich repeat 159..182 CDD:275380 7/22 (32%)
leucine-rich repeat 183..206 CDD:275380 8/22 (36%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..254 CDD:275380 4/22 (18%)
leucine-rich repeat 255..278 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.