DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and lrrc4bb

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_003201401.1 Gene:lrrc4bb / 100535350 ZFINID:ZDB-GENE-091116-44 Length:726 Species:Danio rerio


Alignment Length:341 Identity:93/341 - (27%)
Similarity:144/341 - (42%) Gaps:79/341 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIFSFSPRL-----SCLQLSKCNNTEVTLIRKTELLTSLTLSNCTLPHVENGFFVRFDHLLH 67
            |||......|||     :|..|..|:|....:|             ||                 
Zfish    21 LLLWPHLLGPRLAEASPACPALCSCSNQASRVI-------------CT----------------- 55

  Fly    68 LELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFE 132
                ...|:::.. |::..|:  ||:|..|::..:||.:.:.|..|..|.||.|.:.::.|.:|.
Zfish    56 ----KKSLNEVPQ-SISSNTR--YLNLQENSIQVIRSDTFKHLNHLEILQLSKNQIRQIEVGAFN 113

  Fly   133 QYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEF 197
            ..|.|..|:|..||:..:.:.:|:.||.|:.|:|..|.:..:....|   ||:.||.        
Zfish   114 GLPNLITLELFDNRLPLVPSQAFEYLSKLRELWLRNNPIETLPAYAF---HRVPSLR-------- 167

  Fly   198 IEMDSFESNTHLRSLRLDQNLLSSLQFLSQ---RGLARLVHLNLSSNLLQ---KLEPFVFSKNFE 256
                           |||...|..|.|:|:   .||..|..|||....|:   .|.|.|     .
Zfish   168 ---------------RLDLGELRKLSFISEAAFEGLLNLRFLNLGMCGLKDVPNLTPLV-----R 212

  Fly   257 LQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDN 321
            |::|:||.|.:..:...:..||.||.:|.:.|:.:..|...:.|.|..|.:|::|.|.|.:||.:
Zfish   213 LEELELSGNQLGVVRPGSFQGLVSLRKLWLMHSRISVIERNAFDDLKNLEELNLSHNSLHSLPHD 277

  Fly   322 LFHFNTQLEEIILANN 337
            ||....|||.:.|.:|
Zfish   278 LFTPLQQLERVHLNHN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 2/22 (9%)
LRR_8 64..123 CDD:290566 15/58 (26%)
leucine-rich repeat 65..88 CDD:275380 2/22 (9%)
leucine-rich repeat 89..112 CDD:275380 7/22 (32%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_RI 115..384 CDD:238064 69/229 (30%)
LRR_8 135..195 CDD:290566 18/59 (31%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
LRR_8 184..243 CDD:290566 16/61 (26%)
leucine-rich repeat 185..208 CDD:275380 2/22 (9%)
leucine-rich repeat 209..232 CDD:275380 9/25 (36%)
LRR_8 232..289 CDD:290566 18/59 (31%)
leucine-rich repeat 233..256 CDD:275380 8/25 (32%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
LRR_8 280..339 CDD:290566 21/58 (36%)
leucine-rich repeat 281..304 CDD:275380 6/22 (27%)
leucine-rich repeat 305..328 CDD:275380 9/22 (41%)
lrrc4bbXP_003201401.1 LRRNT 38..72 CDD:214470 10/70 (14%)
LRR_8 68..128 CDD:290566 20/61 (33%)
leucine-rich repeat 70..93 CDD:275380 8/24 (33%)
LRR_RI 85..293 CDD:238064 71/238 (30%)
leucine-rich repeat 94..117 CDD:275380 7/22 (32%)
leucine-rich repeat 118..141 CDD:275380 7/22 (32%)
LRR_8 140..196 CDD:290566 21/81 (26%)
leucine-rich repeat 142..165 CDD:275380 7/25 (28%)
leucine-rich repeat 166..190 CDD:275380 10/46 (22%)
leucine-rich repeat 191..212 CDD:275380 8/25 (32%)
LRR_8 212..271 CDD:290566 18/58 (31%)
leucine-rich repeat 213..236 CDD:275380 7/22 (32%)
leucine-rich repeat 237..260 CDD:275380 6/22 (27%)
leucine-rich repeat 261..282 CDD:275380 9/20 (45%)
TPKR_C2 293..343 CDD:301599 1/1 (100%)
IG_like 352..435 CDD:214653
Ig 360..435 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.