DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and si:dkey-182i3.11

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_021322095.1 Gene:si:dkey-182i3.11 / 100334238 ZFINID:ZDB-GENE-121214-258 Length:710 Species:Danio rerio


Alignment Length:435 Identity:134/435 - (30%)
Similarity:210/435 - (48%) Gaps:33/435 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LIRKTELLTSLTLSNCTLPHVENGFFVRFDHLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSHNN 98
            ::::|..||||.|....:..:.:..|.....|.||:|.::||..:.:.|...|::|.||.||.|.
Zfish   266 VLQETSNLTSLYLQKNDITSIPDNVFSEILSLKHLDLSYNGLVSISNGSFRSLSQLVYLDLSFNQ 330

  Fly    99 LSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKH 163
            |.:|.....|.||.|.||:|.||.|:.|....|:....|::|.|..|.||.|..|.|..||.||.
Zfish   331 LQTLTQHVFEDLGKLENLNLYHNKLTSLPNNMFKNLTMLKELQLDSNNISVIPPDLFHPLSALKD 395

  Fly   164 LYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQR 228
            |.|:.|.::.:....|:.|.:|..|.:..|.:..|....|..|  |:.|.|:.|.:|.:...|.:
Zfish   396 LQLDNNHISKLHSHTFKKLRQLKQLDISSNDLTKIPNHLFHKN--LKELNLENNHISFISKFSFK 458

  Fly   229 GLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDK 293
            .|.||..|.||.|.|.||...:.:....|::|.|:.|.|..:......||::|..|::|:|.:..
Zfish   459 NLHRLQSLKLSHNNLSKLYRELLTNLTRLRELLLNENQIETIPVGFFKGLENLRVLDLSNNKMHF 523

  Fly   294 IYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIKL 358
            |..::.:.|.||..||:|||.|..||:::|.....|.::.|.|||:..:.|::......|..:.|
Zfish   524 ILPDAFNDLSALKDLDLSFNFLHNLPEDIFASLRNLTKLHLQNNKLRYLPSRLFSALVGLEELHL 588

  Fly   359 SGNAISDAAFLDRLSPSVNRFTLYV-----DLSSNRLKSLNLSSLLHFR---YINLADNNWSCNW 415
            ..|      ::.|:.|:  :|...|     |:.||:|:|:...:|:..|   .|:|..|.|.|:.
Zfish   589 DRN------YIQRIHPT--QFEGLVKLHELDMKSNQLRSMEDGTLMPLRKLKRIHLDGNPWDCST 645

  Fly   416 LVANLVQKLPNSVNFARPWTVINNLSENTTNVEGIDCIEGGTNRS 460
            :|          :.:...|  .||   ||..|:.......|.|.|
Zfish   646 VV----------ILYISQW--FNN---NTQLVKTTPMCSSGQNLS 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 6/22 (27%)
LRR_8 64..123 CDD:290566 25/58 (43%)
leucine-rich repeat 65..88 CDD:275380 8/22 (36%)
leucine-rich repeat 89..112 CDD:275380 10/22 (45%)
leucine-rich repeat 113..136 CDD:275380 9/22 (41%)
LRR_RI 115..384 CDD:238064 85/273 (31%)
LRR_8 135..195 CDD:290566 21/59 (36%)
leucine-rich repeat 137..160 CDD:275380 10/22 (45%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
LRR_8 184..243 CDD:290566 19/58 (33%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
LRR_8 232..289 CDD:290566 19/56 (34%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
LRR_8 280..339 CDD:290566 21/58 (36%)
leucine-rich repeat 281..304 CDD:275380 6/22 (27%)
leucine-rich repeat 305..328 CDD:275380 10/22 (45%)
si:dkey-182i3.11XP_021322095.1 PLN00113 97..>617 CDD:331614 115/360 (32%)
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..176 CDD:275380
leucine-rich repeat 177..200 CDD:275380
leucine-rich repeat 201..224 CDD:275380
leucine-rich repeat 225..248 CDD:275380
leucine-rich repeat 249..272 CDD:275380 1/5 (20%)
leucine-rich repeat 273..296 CDD:275380 6/22 (27%)
leucine-rich repeat 297..320 CDD:275380 8/22 (36%)
leucine-rich repeat 321..344 CDD:275380 10/22 (45%)
leucine-rich repeat 345..368 CDD:275380 9/22 (41%)
leucine-rich repeat 369..392 CDD:275380 10/22 (45%)
leucine-rich repeat 393..438 CDD:275380 12/44 (27%)
leucine-rich repeat 417..436 CDD:275380 4/18 (22%)
leucine-rich repeat 439..462 CDD:275380 7/22 (32%)
leucine-rich repeat 463..486 CDD:275380 8/22 (36%)
leucine-rich repeat 487..510 CDD:275380 7/22 (32%)
leucine-rich repeat 511..534 CDD:275380 6/22 (27%)
leucine-rich repeat 535..558 CDD:275380 10/22 (45%)
leucine-rich repeat 559..582 CDD:275380 6/22 (27%)
leucine-rich repeat 583..606 CDD:275380 6/30 (20%)
leucine-rich repeat 607..628 CDD:275380 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.