DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18095 and prelp

DIOPT Version :9

Sequence 1:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_001923590.1 Gene:prelp / 100144408 ZFINID:ZDB-GENE-080327-24 Length:378 Species:Danio rerio


Alignment Length:271 Identity:79/271 - (29%)
Similarity:139/271 - (51%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFR 180
            |.|.:|.:.:::.:||:...:|:.::|..|||..:|...|:.|.:|.:||:..|:|..:......
Zfish   109 LYLQNNYIDQVTAESFKNCTELKWINLGNNRIRSVEKQVFEKLPNLLYLYMQRNELKEVPDDLPA 173

  Fly   181 GLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRG------LARLVHLNLS 239
            ||.:   |.|..|:|..|...:|....||..|.|..|.:|.    |..|      |..|:.|||:
Zfish   174 GLEQ---LRLSRNQISKIPPGAFSKMEHLALLDLHHNRISD----SSMGKNIFKDLKNLIQLNLA 231

  Fly   240 SNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYV-DKIYDESLDSLI 303
            .|:|:|:...:.:..|:   |.|..|||.::.::......||..:.:::|.: ||...:|:.::.
Zfish   232 HNILRKMPANIPNTLFQ---LFLDRNNIEEIPQDYFKNFASLAFVRLNYNQISDKGLPKSVFNVS 293

  Fly   304 ALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISS------QMMFNQN---HLRYIKLS 359
            :||.|.::.|.|:.:|    .||::||::.|.||.||.::.      ..:.::|   .|||::|.
Zfish   294 SLLDLHLAHNKLSNVP----LFNSELEQLHLNNNNIESVNGTEICPPHNVHDENGAPKLRYLRLD 354

  Fly   360 GNAISDAAFLD 370
            ||.:|....||
Zfish   355 GNHLSPPVPLD 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 3/6 (50%)
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380 5/19 (26%)
LRR_RI 115..384 CDD:238064 79/271 (29%)
LRR_8 135..195 CDD:290566 18/59 (31%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
LRR_8 184..243 CDD:290566 20/64 (31%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..232 CDD:275380 8/28 (29%)
LRR_8 232..289 CDD:290566 15/56 (27%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 5/22 (23%)
LRR_8 280..339 CDD:290566 19/59 (32%)
leucine-rich repeat 281..304 CDD:275380 5/23 (22%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
prelpXP_001923590.1 LRRNT 74..106 CDD:214470
leucine-rich repeat 89..105 CDD:275380
leucine-rich repeat 106..129 CDD:275380 5/19 (26%)
LRR_RI <107..319 CDD:238064 64/223 (29%)
LRR_8 128..209 CDD:290566 26/83 (31%)
leucine-rich repeat 130..153 CDD:275380 8/22 (36%)
leucine-rich repeat 154..169 CDD:275380 5/14 (36%)
leucine-rich repeat 175..198 CDD:275380 7/25 (28%)
LRR_8 198..280 CDD:290566 25/88 (28%)
leucine-rich repeat 199..224 CDD:275380 8/28 (29%)
leucine-rich repeat 225..245 CDD:275380 7/19 (37%)
leucine-rich repeat 246..269 CDD:275380 6/25 (24%)
leucine-rich repeat 270..294 CDD:275380 5/23 (22%)
LRR_8 298..358 CDD:290566 20/63 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.