Sequence 1: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001923590.1 | Gene: | prelp / 100144408 | ZFINID: | ZDB-GENE-080327-24 | Length: | 378 | Species: | Danio rerio |
Alignment Length: | 271 | Identity: | 79/271 - (29%) |
---|---|---|---|
Similarity: | 139/271 - (51%) | Gaps: | 30/271 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 116 LDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFR 180
Fly 181 GLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRG------LARLVHLNLS 239
Fly 240 SNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYV-DKIYDESLDSLI 303
Fly 304 ALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISS------QMMFNQN---HLRYIKLS 359
Fly 360 GNAISDAAFLD 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
LRR_8 | 64..123 | CDD:290566 | 3/6 (50%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | |||
leucine-rich repeat | 89..112 | CDD:275380 | |||
leucine-rich repeat | 113..136 | CDD:275380 | 5/19 (26%) | ||
LRR_RI | 115..384 | CDD:238064 | 79/271 (29%) | ||
LRR_8 | 135..195 | CDD:290566 | 18/59 (31%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 184..243 | CDD:290566 | 20/64 (31%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 8/28 (29%) | ||
LRR_8 | 232..289 | CDD:290566 | 15/56 (27%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 280..339 | CDD:290566 | 19/59 (32%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 8/22 (36%) | ||
prelp | XP_001923590.1 | LRRNT | 74..106 | CDD:214470 | |
leucine-rich repeat | 89..105 | CDD:275380 | |||
leucine-rich repeat | 106..129 | CDD:275380 | 5/19 (26%) | ||
LRR_RI | <107..319 | CDD:238064 | 64/223 (29%) | ||
LRR_8 | 128..209 | CDD:290566 | 26/83 (31%) | ||
leucine-rich repeat | 130..153 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 154..169 | CDD:275380 | 5/14 (36%) | ||
leucine-rich repeat | 175..198 | CDD:275380 | 7/25 (28%) | ||
LRR_8 | 198..280 | CDD:290566 | 25/88 (28%) | ||
leucine-rich repeat | 199..224 | CDD:275380 | 8/28 (29%) | ||
leucine-rich repeat | 225..245 | CDD:275380 | 7/19 (37%) | ||
leucine-rich repeat | 246..269 | CDD:275380 | 6/25 (24%) | ||
leucine-rich repeat | 270..294 | CDD:275380 | 5/23 (22%) | ||
LRR_8 | 298..358 | CDD:290566 | 20/63 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |