DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and HAE

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_194578.1 Gene:HAE / 828967 AraportID:AT4G28490 Length:999 Species:Arabidopsis thaliana


Alignment Length:596 Identity:164/596 - (27%)
Similarity:252/596 - (42%) Gaps:92/596 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LPSADPEKEAQILYEKSLQEYHGSQ-LSTASTATDVIAGKRTLHSICERWLQKHCHCTGSLEVLR 162
            |||....::|.||.:..|.....:| ||:.|...||...|         ||...|..|.::..:.
plant    16 LPSLSLNQDATILRQAKLGLSDPAQSLSSWSDNNDVTPCK---------WLGVSCDATSNVVSVD 71

  Fly   163 LSCRGIGILAVP-----VNLPNEVVVLDLGNNNLT-KLEANSFFMAPNLEELTLSDNSIINMDPN 221
            ||.   .:|..|     .:||: :..|.|.||::. .|.|:.|....||..|.||:|.::...|.
plant    72 LSS---FMLVGPFPSILCHLPS-LHSLSLYNNSINGSLSADDFDTCHNLISLDLSENLLVGSIPK 132

  Fly   222 AF-YGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGN 285
            :. :.|..||.|.:....|....|.||....:|.||.|.||.|.......||::..|:.|:|..|
plant   133 SLPFNLPNLKFLEISGNNLSDTIPSSFGEFRKLESLNLAGNFLSGTIPASLGNVTTLKELKLAYN 197

  Fly   286 LF--YRIPTNALAGLRTLEALNL-GSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNLT 347
            ||  .:||:. |..|..|:.|.| |.||:..| .....|:.:|:.|.|..||:.......:..|.
plant   198 LFSPSQIPSQ-LGNLTELQVLWLAGCNLVGPI-PPSLSRLTSLVNLDLTFNQLTGSIPSWITQLK 260

  Fly   348 ALKVLELDDNLIS-SLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRA-----NPLST 406
            .::.:||.:|..| .|||.:..::.|:....:.|:|    ..::|.::.:|::.:     |.|..
plant   261 TVEQIELFNNSFSGELPESMGNMTTLKRFDASMNKL----TGKIPDNLNLLNLESLNLFENMLEG 321

  Fly   407 ISPGAFRGMSKLRKLILSDVRTLRSFP-ELEACHALEILKLDRAGIQ-EVPANLCRQTPRLKSLE 469
            ..|.:......|.:|.|.:.|.....| :|.|...|:.:.|...... |:|||:|.: .:|:.|.
plant   322 PLPESITRSKTLSELKLFNNRLTGVLPSQLGANSPLQYVDLSYNRFSGEIPANVCGE-GKLEYLI 385

  Fly   470 LKTNSL--KRIPNLSSCRD------------------------LRLLDLSSNQIEKIQGKPFNGL 508
            |..||.  :...||..|:.                        |.||:||.|.......|...|.
plant   386 LIDNSFSGEISNNLGKCKSLTRVRLSNNKLSGQIPHGFWGLPRLSLLELSDNSFTGSIPKTIIGA 450

  Fly   509 KQLNDLLLSYNRIK-ALP---------------QDAFQG-IP-------KLQLLDLEGNEISYIH 549
            |.|::|.:|.||.. ::|               ::.|.| ||       :|..|||..|::|...
plant   451 KNLSNLRISKNRFSGSIPNEIGSLNGIIEISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEI 515

  Fly   550 KEAFSGFTALEDLNLGNN-IFPELP-ESGLRALL-HLKTFNNPKLREFPPPDTFPRIQTLILSYA 611
            .....|:..|.:|||.|| :..|:| |.|:..:| :|...:|....|.|......::..|.|||.
plant   516 PRELRGWKNLNELNLANNHLSGEIPKEVGILPVLNYLDLSSNQFSGEIPLELQNLKLNVLNLSYN 580

  Fly   612 YHCCAFLPLVA 622
            :......||.|
plant   581 HLSGKIPPLYA 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 5/25 (20%)
LRR_RI 180..>383 CDD:238064 64/208 (31%)
leucine-rich repeat 183..204 CDD:275380 7/21 (33%)
LRR_8 203..263 CDD:290566 21/60 (35%)
leucine-rich repeat 205..228 CDD:275380 7/23 (30%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..311 CDD:290566 24/61 (39%)
leucine-rich repeat 253..276 CDD:275380 9/22 (41%)
leucine-rich repeat 277..300 CDD:275380 10/24 (42%)
LRR_8 299..359 CDD:290566 17/60 (28%)
leucine-rich repeat 301..324 CDD:275380 8/23 (35%)
leucine-rich repeat 325..348 CDD:275380 6/22 (27%)
LRR_RI 327..567 CDD:238064 72/297 (24%)
leucine-rich repeat 349..371 CDD:275380 7/22 (32%)
LRR_8 370..425 CDD:290566 11/59 (19%)
leucine-rich repeat 372..393 CDD:275380 4/20 (20%)
leucine-rich repeat 394..415 CDD:275380 4/25 (16%)
leucine-rich repeat 418..486 CDD:275380 22/71 (31%)
leucine-rich repeat 441..464 CDD:275378 7/23 (30%)
LRR_8 487..545 CDD:290566 24/81 (30%)
leucine-rich repeat 487..510 CDD:275380 8/22 (36%)
leucine-rich repeat 511..534 CDD:275380 10/46 (22%)
LRR_8 533..589 CDD:290566 20/65 (31%)
leucine-rich repeat 535..558 CDD:275380 7/22 (32%)
leucine-rich repeat 559..580 CDD:275380 10/22 (45%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
HAENP_194578.1 LRRNT_2 21..62 CDD:285463 13/49 (27%)
PLN00113 32..968 CDD:215061 158/580 (27%)
leucine-rich repeat 91..115 CDD:275380 7/23 (30%)
leucine-rich repeat 116..140 CDD:275380 7/23 (30%)
leucine-rich repeat 141..164 CDD:275380 7/22 (32%)
leucine-rich repeat 165..188 CDD:275380 9/22 (41%)
leucine-rich repeat 189..213 CDD:275380 10/24 (42%)
leucine-rich repeat 214..237 CDD:275380 8/23 (35%)
leucine-rich repeat 238..261 CDD:275380 6/22 (27%)
leucine-rich repeat 262..285 CDD:275380 7/22 (32%)
leucine-rich repeat 286..332 CDD:275380 8/49 (16%)
leucine-rich repeat 333..351 CDD:275380 5/17 (29%)
leucine-rich repeat 357..380 CDD:275380 7/23 (30%)
leucine-rich repeat 381..404 CDD:275380 8/22 (36%)
leucine-rich repeat 405..428 CDD:275380 0/22 (0%)
leucine-rich repeat 429..452 CDD:275380 8/22 (36%)
leucine-rich repeat 453..476 CDD:275380 6/22 (27%)
leucine-rich repeat 477..500 CDD:275380 4/22 (18%)
leucine-rich repeat 501..548 CDD:275380 17/46 (37%)
leucine-rich repeat 549..571 CDD:275380 5/21 (24%)
leucine-rich repeat 572..592 CDD:275380 7/20 (35%)
PKc_like 689..967 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.