| Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_075689.1 | Gene: | Ppp1r7 / 66385 | MGIID: | 1913635 | Length: | 361 | Species: | Mus musculus |
| Alignment Length: | 334 | Identity: | 87/334 - (26%) |
|---|---|---|---|
| Similarity: | 151/334 - (45%) | Gaps: | 81/334 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 264 VSLDGDC----LGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPN 324
Fly 325 LIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTE 389
Fly 390 LPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEV 454
Fly 455 PANLCRQTPRLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYN 519
Fly 520 RIKALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNI---FPELPE-SGLRAL 580
Fly 581 LHLKTFNNP 589 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | |
| LRR_RI | 180..>383 | CDD:238064 | 39/122 (32%) | ||
| leucine-rich repeat | 183..204 | CDD:275380 | |||
| LRR_8 | 203..263 | CDD:290566 | |||
| leucine-rich repeat | 205..228 | CDD:275380 | |||
| leucine-rich repeat | 229..252 | CDD:275380 | |||
| LRR_8 | 252..311 | CDD:290566 | 13/50 (26%) | ||
| leucine-rich repeat | 253..276 | CDD:275380 | 5/15 (33%) | ||
| leucine-rich repeat | 277..300 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 299..359 | CDD:290566 | 21/59 (36%) | ||
| leucine-rich repeat | 301..324 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 325..348 | CDD:275380 | 10/22 (45%) | ||
| LRR_RI | 327..567 | CDD:238064 | 62/239 (26%) | ||
| leucine-rich repeat | 349..371 | CDD:275380 | 8/21 (38%) | ||
| LRR_8 | 370..425 | CDD:290566 | 10/54 (19%) | ||
| leucine-rich repeat | 372..393 | CDD:275380 | 4/20 (20%) | ||
| leucine-rich repeat | 394..415 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 418..486 | CDD:275380 | 9/67 (13%) | ||
| leucine-rich repeat | 441..464 | CDD:275378 | 0/22 (0%) | ||
| LRR_8 | 487..545 | CDD:290566 | 19/57 (33%) | ||
| leucine-rich repeat | 487..510 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 511..534 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 533..589 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 535..558 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 559..580 | CDD:275380 | 6/24 (25%) | ||
| 7tm_4 | 764..>892 | CDD:304433 | |||
| 7tm_1 | 770..1017 | CDD:278431 | |||
| Ppp1r7 | NP_075689.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..64 | ||
| LRR 1 | 78..99 | 7/33 (21%) | |||
| LRR_4 | 99..140 | CDD:289563 | 14/44 (32%) | ||
| LRR 2 | 100..121 | 6/22 (27%) | |||
| leucine-rich repeat | 101..122 | CDD:275380 | 6/22 (27%) | ||
| LRR_4 | 121..163 | CDD:289563 | 17/44 (39%) | ||
| LRR_8 | 122..177 | CDD:290566 | 23/57 (40%) | ||
| LRR 3 | 122..143 | 9/22 (41%) | |||
| leucine-rich repeat | 123..144 | CDD:275380 | 10/22 (45%) | ||
| LRR_4 | 143..185 | CDD:289563 | 14/42 (33%) | ||
| LRR 4 | 144..165 | 7/21 (33%) | |||
| leucine-rich repeat | 145..166 | CDD:275380 | 8/21 (38%) | ||
| LRR_8 | 165..221 | CDD:290566 | 17/104 (16%) | ||
| LRR 5 | 166..187 | 5/20 (25%) | |||
| leucine-rich repeat | 167..188 | CDD:275380 | 4/20 (20%) | ||
| LRR_4 | 188..227 | CDD:289563 | 12/87 (14%) | ||
| LRR 6 | 188..209 | 6/36 (17%) | |||
| leucine-rich repeat | 189..210 | CDD:275380 | 7/36 (19%) | ||
| LRR_4 | 209..251 | CDD:289563 | 14/76 (18%) | ||
| LRR 7 | 210..231 | 7/53 (13%) | |||
| leucine-rich repeat | 211..232 | CDD:275380 | 7/20 (35%) | ||
| LRR_8 | 231..287 | CDD:290566 | 19/59 (32%) | ||
| LRR 8 | 232..253 | 7/22 (32%) | |||
| leucine-rich repeat | 233..254 | CDD:275380 | 8/22 (36%) | ||
| LRR_4 | 254..295 | CDD:289563 | 14/44 (32%) | ||
| LRR 9 | 254..275 | 6/22 (27%) | |||
| leucine-rich repeat | 255..276 | CDD:275380 | 6/22 (27%) | ||
| LRR_4 | 276..317 | CDD:289563 | 13/42 (31%) | ||
| LRR 10 | 276..297 | 9/22 (41%) | |||
| leucine-rich repeat | 277..298 | CDD:275380 | 8/22 (36%) | ||
| LRR 11 | 298..319 | 4/20 (20%) | |||
| LRRcap | 337..355 | CDD:197729 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||