DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rk and Pidd1

DIOPT Version :9

Sequence 1:	NP_476702.1	Gene:	rk / 34819	FlyBaseID:	FBgn0003255	Length:	1360	Species:	Drosophila melanogaster
Sequence 2:	NP_073145.1	Gene:	Pidd1 / 57913	MGIID:	1889507	Length:	915	Species:	Mus musculus

Alignment Length:	198	Identity:	67/198 - (33%)
Similarity:	96/198 - (48%)	Gaps:	23/198 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   220 PNAFYGLAKLKRLSLQNCGLKSLP---PQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLR 281
            |.....||.|..|.|....|::||   |:    |..|.:|.|:.|.|..|. :.||.|..|..|.
Mouse   123 PAGLSDLACLAHLDLSFNRLETLPTCVPE----LHGLDALLLSHNHLSELP-EALGALPALTFLT 182

  Fly   282 LEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
            :..|...|:|. .|..|.||:.|:|..|||..|..| ...:.:|..|.|..|::..:.| :|..|
Mouse   183 VTHNRLERLPL-TLGSLSTLQRLDLSENLLDTIPSE-IGNLRSLSELNLASNRLQSLPA-SLAGL 244

  Fly   347 TALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLD-----MRANPLST 406
            .:|::|.|..||::|:|.||..|..:..|.:..||||     :||  .::||     ::.|||..
Mouse   245 RSLRLLVLHSNLLTSVPTGLVHLPLITRLDLRDNRLR-----DLP--AELLDAPFVRLQGNPLGE 302

  Fly   407 ISP 409
            .||
Mouse   303 ASP 305

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rk	NP_476702.1	leucine-rich repeat	158..179	CDD:275380
		LRR_RI	180..>383	CDD:238064	56/165 (34%)
		leucine-rich repeat	183..204	CDD:275380
		LRR_8	203..263	CDD:290566	15/45 (33%)
		leucine-rich repeat	205..228	CDD:275380	2/7 (29%)
		leucine-rich repeat	229..252	CDD:275380	8/25 (32%)
		LRR_8	252..311	CDD:290566	21/58 (36%)
		leucine-rich repeat	253..276	CDD:275380	9/22 (41%)
		leucine-rich repeat	277..300	CDD:275380	7/22 (32%)
		LRR_8	299..359	CDD:290566	20/59 (34%)
		leucine-rich repeat	301..324	CDD:275380	8/22 (36%)
		leucine-rich repeat	325..348	CDD:275380	7/22 (32%)
		LRR_RI	327..567	CDD:238064	30/88 (34%)
		leucine-rich repeat	349..371	CDD:275380	10/21 (48%)
		LRR_8	370..425	CDD:290566	14/45 (31%)
		leucine-rich repeat	372..393	CDD:275380	7/20 (35%)
		leucine-rich repeat	394..415	CDD:275380	7/21 (33%)
		leucine-rich repeat	418..486	CDD:275380
		leucine-rich repeat	441..464	CDD:275378
		LRR_8	487..545	CDD:290566
		leucine-rich repeat	487..510	CDD:275380
		leucine-rich repeat	511..534	CDD:275380
		LRR_8	533..589	CDD:290566
		leucine-rich repeat	535..558	CDD:275380
		leucine-rich repeat	559..580	CDD:275380
		7tm_4	764..>892	CDD:304433
		7tm_1	770..1017	CDD:278431
Pidd1	NP_073145.1	LRR 1	131..152		7/24 (29%)
		LRR_RI	<132..295	CDD:238064	59/177 (33%)
		LRR_8	132..188	CDD:290566	20/60 (33%)
		leucine-rich repeat	132..154	CDD:275380	8/25 (32%)
		LRR 2	154..176		8/22 (36%)
		leucine-rich repeat	155..177	CDD:275380	9/22 (41%)
		LRR_8	176..234	CDD:290566	20/59 (34%)
		LRR 3	177..199		6/22 (27%)
		leucine-rich repeat	178..200	CDD:275380	7/22 (32%)
		LRR 4	200..221		9/21 (43%)
		leucine-rich repeat	201..223	CDD:275380	8/22 (36%)
		LRR_8	222..280	CDD:290566	19/58 (33%)
		LRR 5	223..245		6/22 (27%)
		leucine-rich repeat	224..246	CDD:275380	7/22 (32%)
		LRR 6	246..268		9/21 (43%)
		leucine-rich repeat	247..269	CDD:275380	10/21 (48%)
		LRR 7	269..290		8/27 (30%)
		leucine-rich repeat	270..289	CDD:275380	7/25 (28%)
		ZU5	330..403	CDD:295340
		Peptidase_S68	426..458	CDD:287439
		Peptidase S68. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00485	428..457
		ZU5	469..542	CDD:295340
		Peptidase S68. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00485	571..599
		UPA domain. /evidence=ECO:0000250	585..721
		DD	793..878	CDD:301326
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	888..915
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910