DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and LRCH2

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_065922.3 Gene:LRCH2 / 57631 HGNCID:29292 Length:765 Species:Homo sapiens


Alignment Length:325 Identity:87/325 - (26%)
Similarity:131/325 - (40%) Gaps:50/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 GIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKR 231
            |.|.|.||:.:|.              |....|...|.....:|.....:.....|.........
Human    42 GGGTLVVPIPVPT--------------LFGQPFPNGPPWNPGSLQPQHTVRSLDRALEEAGSSGI 92

  Fly   232 LSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALA 296
            |||....|:..|...:. |...|...|:.|....:..| :.....|.||.|..|....|| .|:.
Human    93 LSLSGRKLRDFPGSGYD-LTDTTQADLSRNRFTEIPSD-VWLFAPLETLNLYHNCIKTIP-EAIK 154

  Fly   297 GLRTLEALNLGSNLLTIINDE--DFPRMPNLIVLLLKRNQIMKI--SAGALKNLTALKVLELDDN 357
            .|:.|..||:..|||:.:...  |.|    |.||::..|:::.|  ..|.||:|..   |::..|
Human   155 NLQMLTYLNISRNLLSTLPKYLFDLP----LKVLVVSNNKLVSIPEEIGKLKDLME---LDISCN 212

  Fly   358 LISSLPEGLSKLSQLQELSITSNRLRWINDT--ELPRSMQMLDMRANPLSTISPGAFRGMSKLRK 420
            .|..||:.:.||..|:||:|..|.|..:.|.  :||  :..||...|.::.| |..:|.:..|:.
Human   213 EIQVLPQQMGKLHSLRELNIRRNNLHVLPDELGDLP--LVKLDFSCNKVTEI-PVCYRKLHHLQV 274

  Fly   421 LILSDVRTLRSFPELEAC-----HALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPN 480
            :|| |...|: .|..:.|     |..:.|.:...         ||...:..||:|.:.| ||:|:
Human   275 IIL-DNNPLQ-VPPAQICLKGKVHIFKYLNIQAC---------CRMDKKPDSLDLPSLS-KRMPS 327

  Fly   481  480
            Human   328  327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 5/11 (45%)
LRR_RI 180..>383 CDD:238064 53/206 (26%)
leucine-rich repeat 183..204 CDD:275380 2/20 (10%)
LRR_8 203..263 CDD:290566 12/59 (20%)
leucine-rich repeat 205..228 CDD:275380 2/22 (9%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..311 CDD:290566 17/58 (29%)
leucine-rich repeat 253..276 CDD:275380 4/22 (18%)
leucine-rich repeat 277..300 CDD:275380 9/22 (41%)
LRR_8 299..359 CDD:290566 19/63 (30%)
leucine-rich repeat 301..324 CDD:275380 8/24 (33%)
leucine-rich repeat 325..348 CDD:275380 9/24 (38%)
LRR_RI 327..567 CDD:238064 48/163 (29%)
leucine-rich repeat 349..371 CDD:275380 7/21 (33%)
LRR_8 370..425 CDD:290566 18/56 (32%)
leucine-rich repeat 372..393 CDD:275380 9/22 (41%)
leucine-rich repeat 394..415 CDD:275380 6/20 (30%)
leucine-rich repeat 418..486 CDD:275380 18/68 (26%)
leucine-rich repeat 441..464 CDD:275378 3/22 (14%)
LRR_8 487..545 CDD:290566
leucine-rich repeat 487..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
LRR_8 533..589 CDD:290566
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
LRCH2NP_065922.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..76 4/20 (20%)
LRR 1 89..110 5/21 (24%)
leucine-rich repeat 92..112 CDD:275380 6/20 (30%)
LRR 2 112..133 4/21 (19%)
leucine-rich repeat 113..135 CDD:275380 4/22 (18%)
LRR 3 135..156 8/21 (38%)
LRR_RI <136..237 CDD:238064 38/108 (35%)
LRR_8 136..191 CDD:290566 21/59 (36%)
LRR_4 136..173 CDD:289563 15/37 (41%)
leucine-rich repeat 136..158 CDD:275380 9/22 (41%)
LRR 4 158..179 6/20 (30%)
leucine-rich repeat 159..174 CDD:275380 6/14 (43%)
LRR 5 180..201 7/24 (29%)
LRR_8 181..237 CDD:290566 21/58 (36%)
leucine-rich repeat 181..203 CDD:275380 7/21 (33%)
LRR 6 203..224 6/23 (26%)
leucine-rich repeat 204..226 CDD:275380 8/24 (33%)
LRR_8 226..282 CDD:290566 19/59 (32%)
LRR 7 226..248 7/21 (33%)
leucine-rich repeat 227..247 CDD:275380 7/19 (37%)
leucine-rich repeat 249..271 CDD:275380 6/22 (27%)
LRR 8 249..269 6/20 (30%)
LRR 9 271..292 7/22 (32%)
leucine-rich repeat 272..290 CDD:275380 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..401 6/13 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..552
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 565..628
CH 644..751 CDD:278723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.