DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and APL1A

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_001688066.1 Gene:APL1A / 5666905 VectorBaseID:AGAP007036 Length:428 Species:Anopheles gambiae


Alignment Length:465 Identity:118/465 - (25%)
Similarity:192/465 - (41%) Gaps:98/465 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 WLQKHCHCTGSLEVLRLSCRGIG---ILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAP----- 203
            ||:    ....:.|:.|:|...|   ..:.|:          .||..........:::.|     
Mosquito     3 WLR----AVSQISVIFLACTNGGQPSYRSQPI----------YGNKQRYYGNQQYYYVKPLQPEY 53

  Fly   204 -----NLEELTLSDNSIINM-DPNAFYG-----LAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQ 257
                 ||:...:..|..|:| ..:.::|     |...|.::.:|..::.||..|.....|:..|.
Mosquito    54 KCIEKNLQYDCVFYNVHIDMQSQDVYFGFDDITLNNQKNVTFKNSTMRKLPAASLASFRQVEVLN 118

  Fly   258 LNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRM 322
            |||                   |::|     .|.|||.|...|::.|.:|.|.:..:....|..:
Mosquito   119 LNG-------------------LQIE-----EIDTNAFAYAHTIQKLYMGFNAIRYLPPHVFQNV 159

  Fly   323 PNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSL-PEGLSKLSQLQELSITSNRLRWIN 386
            |:|.||:|:||.:..:..|...|...|.:|.:.:|.:..: .|.....:.||.|.::||||..: 
Mosquito   160 PSLTVLVLERNDLTSLPRGIFHNTPKLTMLSMSNNNLERIEDETFQATTTLQNLQLSSNRLTHV- 223

  Fly   387 DTELPRSMQMLDMRANPLSTIS-PGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAG 450
            |..|..|:..:::..|.|||:: |.|..                    ||:|.|         ..
Mosquito   224 DLALIPSLFHVNVSYNLLSTLAIPIAVE--------------------ELDASH---------NS 259

  Fly   451 IQEV--PANLCRQTPRLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLND 513
            |..|  |.|:     .|..|:|:.|:|.....|.:...|..:|||.|::|||..:.|..:::|..
Mosquito   260 INAVRGPVNM-----ELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYRYFVKMQRLER 319

  Fly   514 LLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLR 578
            |.:|.||:.||.... |.||.|::|||..|.:.::.:.. ..|..||:|.|.:|....|..|...
Mosquito   320 LYVSNNRLVALNLYG-QPIPTLKVLDLSHNHLLHVERNQ-PQFDRLENLYLDHNSIVTLNLSTSH 382

  Fly   579 ALLHLKTFNN 588
            .|.:||..:|
Mosquito   383 TLKNLKLSHN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 5/23 (22%)
LRR_RI 180..>383 CDD:238064 51/219 (23%)
leucine-rich repeat 183..204 CDD:275380 3/30 (10%)
LRR_8 203..263 CDD:290566 18/75 (24%)
leucine-rich repeat 205..228 CDD:275380 6/28 (21%)
leucine-rich repeat 229..252 CDD:275380 5/22 (23%)
LRR_8 252..311 CDD:290566 16/58 (28%)
leucine-rich repeat 253..276 CDD:275380 4/22 (18%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
LRR_8 299..359 CDD:290566 17/59 (29%)
leucine-rich repeat 301..324 CDD:275380 4/22 (18%)
leucine-rich repeat 325..348 CDD:275380 8/22 (36%)
LRR_RI 327..567 CDD:238064 70/243 (29%)
leucine-rich repeat 349..371 CDD:275380 4/22 (18%)
LRR_8 370..425 CDD:290566 16/55 (29%)
leucine-rich repeat 372..393 CDD:275380 9/20 (45%)
leucine-rich repeat 394..415 CDD:275380 6/21 (29%)
leucine-rich repeat 418..486 CDD:275380 14/69 (20%)
leucine-rich repeat 441..464 CDD:275378 4/24 (17%)
LRR_8 487..545 CDD:290566 24/57 (42%)
leucine-rich repeat 487..510 CDD:275380 9/22 (41%)
leucine-rich repeat 511..534 CDD:275380 9/22 (41%)
LRR_8 533..589 CDD:290566 18/56 (32%)
leucine-rich repeat 535..558 CDD:275380 6/22 (27%)
leucine-rich repeat 559..580 CDD:275380 7/20 (35%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
APL1AXP_001688066.1 LRR_8 112..172 CDD:290566 24/83 (29%)
leucine-rich repeat 114..137 CDD:275380 11/46 (24%)
leucine-rich repeat 138..161 CDD:275380 4/22 (18%)
LRR_RI 160..402 CDD:238064 79/270 (29%)
LRR_8 160..220 CDD:290566 18/59 (31%)
leucine-rich repeat 162..185 CDD:275380 8/22 (36%)
leucine-rich repeat 186..209 CDD:275380 4/22 (18%)
leucine-rich repeat 210..230 CDD:275380 9/20 (45%)
leucine-rich repeat 231..255 CDD:275380 8/43 (19%)
LRR_8 270..327 CDD:290566 19/56 (34%)
leucine-rich repeat 271..292 CDD:275380 6/20 (30%)
leucine-rich repeat 293..316 CDD:275380 9/22 (41%)
LRR_8 316..373 CDD:290566 21/58 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.