DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and LOC563710

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_692159.4 Gene:LOC563710 / 563710 -ID:- Length:635 Species:Danio rerio


Alignment Length:372 Identity:103/372 - (27%)
Similarity:161/372 - (43%) Gaps:41/372 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 ERWLQKHCHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELT 209
            ||...:.|.|.|.:    :.|.......||.||......|.|..|:|..|:|..|.....|..|.
Zfish    28 ERPCPRSCRCDGKI----VYCESSAFRDVPKNLSGGCQGLSLRYNSLASLKAGQFVGLNQLIWLY 88

  Fly   210 LSDNSIINMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHL 274
            |..|.|.|:|..||.|:.:||.|.|.:..:..|...:|..:..|.:|.|:.|.|.:|.......|
Zfish    89 LDHNYIANVDARAFQGIRRLKELILSSNKITLLHNTTFHLVPNLRNLDLSYNKLQALQPGQFQGL 153

  Fly   275 QKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKIS 339
            :||.:|.:..|....:|:......|.||.|:||.|.|..|.......:..|..|.::.||..||:
Zfish   154 RKLLSLHMRSNSLKNLPSRLFQDCRNLEFLDLGYNRLRSITRNSMSGLLKLTELHIEHNQFSKIN 218

  Fly   340 AGALKNLTALKVLELDDNLISSLPEGLSKL-SQLQELSITSNRLRWINDTELPRSM---QMLDMR 400
            .........|:.|.|..|.|.::.|||:.: :.||:|.::.|.|:.| |.|:.|:|   |.|::.
Zfish   219 FFNFPRFYNLRALYLQWNRIRTMSEGLTWMWTSLQKLDLSGNDLQEI-DAEVYRAMPNLQTLNLD 282

  Fly   401 ANPLSTISPGAFRGMSKLRKLILSD---------------VRTLRSFPELE-ACHALEILKLDRA 449
            :|.|..:|..|....:.|..:.|:.               :||.|...|:. .|.:.:.::.::.
Zfish   283 SNKLVNVSQEAVDAWTSLTAISLAGNMWDCGPVVCPLVAWMRTFRGNKEINMICASPKEVQGEKV 347

  Fly   450 GIQEVPAN-LCR------------QTPRLKSLELKTNSLKRIPNLSS 483
             :..|.|| :||            .||.:...:...:||  :|.|.|
Zfish   348 -LDAVDANGVCRIAPATPSTIFVPSTPFVAFSQTPASSL--VPTLKS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 5/20 (25%)
LRR_RI 180..>383 CDD:238064 62/203 (31%)
leucine-rich repeat 183..204 CDD:275380 7/20 (35%)
LRR_8 203..263 CDD:290566 20/59 (34%)
leucine-rich repeat 205..228 CDD:275380 10/22 (45%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..311 CDD:290566 19/58 (33%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 4/22 (18%)
LRR_8 299..359 CDD:290566 19/59 (32%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..348 CDD:275380 6/22 (27%)
LRR_RI 327..567 CDD:238064 48/190 (25%)
leucine-rich repeat 349..371 CDD:275380 8/22 (36%)
LRR_8 370..425 CDD:290566 18/57 (32%)
leucine-rich repeat 372..393 CDD:275380 8/20 (40%)
leucine-rich repeat 394..415 CDD:275380 7/23 (30%)
leucine-rich repeat 418..486 CDD:275380 19/95 (20%)
leucine-rich repeat 441..464 CDD:275378 6/35 (17%)
LRR_8 487..545 CDD:290566
leucine-rich repeat 487..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
LRR_8 533..589 CDD:290566
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
LOC563710XP_692159.4 leucine-rich repeat 60..83 CDD:275380 7/22 (32%)
LRR_RI <81..286 CDD:238064 64/205 (31%)
LRR_8 83..142 CDD:290566 20/58 (34%)
leucine-rich repeat 84..107 CDD:275380 10/22 (45%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
LRR_8 130..190 CDD:290566 19/59 (32%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 4/22 (18%)
LRR_8 178..238 CDD:290566 19/59 (32%)
leucine-rich repeat 180..203 CDD:275380 8/22 (36%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
LRR_8 250..308 CDD:290566 18/58 (31%)
leucine-rich repeat 252..275 CDD:275380 10/23 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.