DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and zgc:113307

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001018560.1 Gene:zgc:113307 / 553753 ZFINID:ZDB-GENE-050522-29 Length:343 Species:Danio rerio


Alignment Length:405 Identity:97/405 - (23%)
Similarity:148/405 - (36%) Gaps:119/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LDLGNNNLTKLEANSFFMAPNLEELTLSDN------SIINMD------------PNAFY------ 224
            ||.|.   ..|..|.|...|::  |||.|.      ..:|..            |.|.|      
Zfish     3 LDYGG---VPLWINRFLGEPSV--LTLKDRIDPGWYRAVNTQSCPLECDCPIQWPTAIYCDHRGL 62

  Fly   225 -----GLA-KLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVS--LDGDCLGHLQKLRTLR 281
                 ||. :|:.|.||...:.||..::|.....|..|.|:.|.|:|  ||......|.:|..|.
Zfish    63 NQLPSGLPFRLQYLFLQGNNITSLGSRAFDNTTYLRWLILDHNELLSEQLDNVLFSSLTRLVNLF 127

  Fly   282 LEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
            :..|...::|....:||:   .|.|..|.:..|::.||..:.:|.::||:.|::..|..|..|.|
Zfish   128 INHNNLTKVPAGLPSGLK---QLRLAYNHIEKISEGDFQNLDSLTLILLQGNRLKTIEEGDFKGL 189

  Fly   347 TALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPGA 411
            .||.:|:|..|.:.:.|:                        .||.|:|.|.:..|.|:.:|..:
Zfish   190 GALNLLDLSHNFLDTFPK------------------------HLPPSVQQLYLSNNSLTGLSENS 230

  Fly   412 FRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLK 476
            ....|.||.|                                          ||...:|:...|.
Zfish   231 LHAFSGLRYL------------------------------------------RLGHNKLRNERLD 253

  Fly   477 RIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAF------QGIPKL 535
              |...:...|..||||.|::.:|...|..    |..|.|..|.|:.....:|      ....::
Zfish   254 --PGAFNLTSLVELDLSYNRLTEIPSVPIT----LQYLYLEVNHIQEFNVSSFCRTVGPTSYSRM 312

  Fly   536 QLLDLEGNEISYIHK 550
            ::|.|:||::.| ||
Zfish   313 KILRLDGNKLEY-HK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 59/230 (26%)
leucine-rich repeat 183..204 CDD:275380 6/19 (32%)
LRR_8 203..263 CDD:290566 22/89 (25%)
leucine-rich repeat 205..228 CDD:275380 10/52 (19%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..311 CDD:290566 18/60 (30%)
leucine-rich repeat 253..276 CDD:275380 9/24 (38%)
leucine-rich repeat 277..300 CDD:275380 6/22 (27%)
LRR_8 299..359 CDD:290566 19/59 (32%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..348 CDD:275380 8/22 (36%)
LRR_RI 327..567 CDD:238064 51/230 (22%)
leucine-rich repeat 349..371 CDD:275380 5/21 (24%)
LRR_8 370..425 CDD:290566 12/54 (22%)
leucine-rich repeat 372..393 CDD:275380 2/20 (10%)
leucine-rich repeat 394..415 CDD:275380 5/20 (25%)
leucine-rich repeat 418..486 CDD:275380 8/67 (12%)
leucine-rich repeat 441..464 CDD:275378 0/22 (0%)
LRR_8 487..545 CDD:290566 18/63 (29%)
leucine-rich repeat 487..510 CDD:275380 8/22 (36%)
leucine-rich repeat 511..534 CDD:275380 6/28 (21%)
LRR_8 533..589 CDD:290566 7/18 (39%)
leucine-rich repeat 535..558 CDD:275380 7/16 (44%)
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
zgc:113307NP_001018560.1 LRRNT 41..70 CDD:214470 4/28 (14%)
leucine-rich repeat 56..72 CDD:275380 3/15 (20%)
LRR_RI <60..274 CDD:238064 67/284 (24%)
LRR_8 72..133 CDD:290566 19/60 (32%)
leucine-rich repeat 73..96 CDD:275380 7/22 (32%)
leucine-rich repeat 97..122 CDD:275380 9/24 (38%)
leucine-rich repeat 123..146 CDD:275380 6/25 (24%)
LRR_8 142..200 CDD:290566 20/60 (33%)
leucine-rich repeat 147..167 CDD:275380 6/19 (32%)
leucine-rich repeat 168..191 CDD:275380 8/22 (36%)
leucine-rich repeat 192..212 CDD:275380 7/43 (16%)
LRR_8 211..272 CDD:290566 21/104 (20%)
leucine-rich repeat 213..236 CDD:275380 5/22 (23%)
leucine-rich repeat 237..261 CDD:275380 8/67 (12%)
leucine-rich repeat 282..311 CDD:275380 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.