powered by:
Protein Alignment rk and cetn3
DIOPT Version :9
Sequence 1: | NP_476702.1 |
Gene: | rk / 34819 |
FlyBaseID: | FBgn0003255 |
Length: | 1360 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016387.1 |
Gene: | cetn3 / 549141 |
XenbaseID: | XB-GENE-1001054 |
Length: | 167 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 15/66 - (22%) |
Similarity: | 26/66 - (39%) |
Gaps: | 14/66 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1266 KPRLVRQEAVQEEEDS--------------SPPRLGVRFLPTIPSAADSSVVMEDGDSANTGVAS 1316
|.|.:.:|..||.:|: ...::.:|.|......||...:::|.|...||..:
Frog 18 KRRELTEEQKQEIKDAFELFDTDKDKAIDYHELKVAMRALGFDVKKADVLKILKDYDGETTGKIT 82
Fly 1317 F 1317
|
Frog 83 F 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.