DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and Tlr5

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_017177186.1 Gene:Tlr5 / 53791 MGIID:1858171 Length:873 Species:Mus musculus


Alignment Length:614 Identity:149/614 - (24%)
Similarity:246/614 - (40%) Gaps:141/614 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 EVLRLSCRGIG-ILAVPVNLPNEVVVLDLGNN--NLTKLEANSFFMAPNLEELTLSDNSIINMDP 220
            |.|.||...|. ::|....|...:.:|:||..  ||| :...:|...|||..|.|..:.|..::.
Mouse    64 ERLLLSFNYISMVVATSFPLLERLQLLELG
TQYANLT-IGPGAFRNLPNLRILDLGQSQIEVLNR 127

  Fly   221 NAFYGLAKLKRLSLQNCGLKS--LPPQSFQGLAQLTSLQLNGNALVSL-------------DGD- 269
            :||.||..|..|.|.:|||.|  |....|:.|..|..|.|:||.:.||             |.: 
Mouse   128 DAFQGLPHLLELRLFSCGLSSAVLSDGYFRNLYSLARLDLSGNQIHSLRLHSSFRELNSLSDVNF 192

  Fly   270 --------CLGHLQKL--RTLRLEG----NLFYRIPT------NALAGLRTLEALNLGSNLLTII 314
                    |...|:.|  :||...|    .||.|:..      |...|:| ||.|:|..|..|:.
Mouse   193 AFNQIFTICEDELEPLQGKTLSFFGLKLTKLFSRVSVGWETCRNPFRGVR-LETLDLSENGWTVD 256

  Fly   315 NDEDFPRM--PNLIVLLLKRNQIMKISAG----------ALKNLTALKVLELD--DNLISSL-PE 364
            ...:|..:  .:.|..|:.::.||....|          ...:|....||:||  ...|.|| |.
Mouse   257 ITRNFSNIIQGSQISSLILKHHIMGPGFGFQNIRDPDQSTFASLARSSVLQLDLSHGFIFSLNPR 321

  Fly   365 GLSKLSQLQELSITSNRLRWINDTEL--PRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDVR 427
            ....|..|:.|::..|::..|.:...  ..|:|:|::..|.|..:....|.|:.::         
Mouse   322 LFGTLKDLKMLNLAFNKINKIGENAFYGLDSLQVLNLSYNLLGELYNSNFYGLPRV--------- 377

  Fly   428 TLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSSCRDLRL--- 489
               ::.:|:..|         .||  :.....|....|::|:|:.|:||.|..:.|.:.:.|   
Mouse   378 ---AYVDLQRNH---------IGI--IQDQTFRLLKTLQTLDLRDNALKAIGFIPSIQMVLLGGN 428

  Fly   490 --------------LDLSSNQIEKIQGKPF-NGLKQLNDLLLSYNRIKA---------------- 523
                          |:||.|::|.:....| ..:.||..|:|:.||:.:                
Mouse   429 KLVHLPHIHFTANFLELSENRLENLSDLYFLLRVPQLQFLILNQNRLSSCKAAHTPSENPSLEQL 493

  Fly   524 --------------LPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPE 574
                          |..|.|||:.:||:|.|..|.::::....|:...||..|:|..|....|..
Mouse   494 FLTENMLQLAWETGLCWDVFQGLSRLQILYLSNNYLNFLPPGIFNDLVALRMLSLSANKLTVLSP 558

  Fly   575 SGLRALLHLKTFNNPKLREFPPPDTFPRIQTLILSY-AYHC-CAFLPLVAMSSQKKTSQVQEAVL 637
            ..|.|.|.:...:..:|.. |.|..|..::.|.::: .:.| |.....::..:|...:      |
Mouse   559 GSLPANLEILDISRNQLFS-PDPALFSSLRVLDITHNEFVCNCELSTFISWLNQTNVT------L 616

  Fly   638 FPSDAEFDMTLWNNSMMNIWPQMHNLSKQ 666
            |.|.|:. ..::.||::.  ..::|:|.:
Mouse   617 FGSPADV-YCMYPNSLLG--GSLYNISTE 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 7/20 (35%)
LRR_RI 180..>383 CDD:238064 72/255 (28%)
leucine-rich repeat 183..204 CDD:275380 7/22 (32%)
LRR_8 203..263 CDD:290566 25/61 (41%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
leucine-rich repeat 229..252 CDD:275380 10/24 (42%)
LRR_8 252..311 CDD:290566 25/92 (27%)
leucine-rich repeat 253..276 CDD:275380 10/44 (23%)
leucine-rich repeat 277..300 CDD:275380 9/34 (26%)
LRR_8 299..359 CDD:290566 18/73 (25%)
leucine-rich repeat 301..324 CDD:275380 7/24 (29%)
leucine-rich repeat 325..348 CDD:275380 6/32 (19%)
LRR_RI 327..567 CDD:238064 66/302 (22%)
leucine-rich repeat 349..371 CDD:275380 9/24 (38%)
LRR_8 370..425 CDD:290566 11/56 (20%)
leucine-rich repeat 372..393 CDD:275380 4/22 (18%)
leucine-rich repeat 394..415 CDD:275380 5/20 (25%)
leucine-rich repeat 418..486 CDD:275380 13/67 (19%)
leucine-rich repeat 441..464 CDD:275378 3/22 (14%)
LRR_8 487..545 CDD:290566 23/105 (22%)
leucine-rich repeat 487..510 CDD:275380 7/40 (18%)
leucine-rich repeat 511..534 CDD:275380 10/52 (19%)
LRR_8 533..589 CDD:290566 15/55 (27%)
leucine-rich repeat 535..558 CDD:275380 6/22 (27%)
leucine-rich repeat 559..580 CDD:275380 6/20 (30%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
Tlr5XP_017177186.1 leucine-rich repeat 63..93 CDD:275380 8/28 (29%)
LRR_8 <101..146 CDD:338972 15/44 (34%)
leucine-rich repeat 112..135 CDD:275380 8/22 (36%)
leucine-rich repeat 136..161 CDD:275380 10/24 (42%)
leucine-rich repeat 162..186 CDD:275380 7/23 (30%)
leucine-rich repeat 187..242 CDD:275380 12/54 (22%)
leucine-rich repeat 243..304 CDD:275380 13/60 (22%)
leucine-rich repeat 305..328 CDD:275380 9/22 (41%)
LRR_8 308..363 CDD:338972 15/54 (28%)
leucine-rich repeat 329..352 CDD:275380 4/22 (18%)
LRR_8 352..411 CDD:338972 16/81 (20%)
leucine-rich repeat 353..376 CDD:275380 6/22 (27%)
leucine-rich repeat 377..400 CDD:275380 5/45 (11%)
PRK15370 <397..>597 CDD:185268 46/200 (23%)
leucine-rich repeat 401..429 CDD:275380 9/27 (33%)
leucine-rich repeat 430..464 CDD:275380 6/33 (18%)
leucine-rich repeat 465..489 CDD:275380 5/23 (22%)
leucine-rich repeat 490..518 CDD:275380 5/27 (19%)
leucine-rich repeat 519..542 CDD:275380 6/22 (27%)
leucine-rich repeat 543..561 CDD:275380 5/17 (29%)
leucine-rich repeat 565..585 CDD:275380 5/20 (25%)
PCC 569..>647 CDD:188093 16/84 (19%)
TIR 708..858 CDD:366714
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.