DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and pxdn

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001076815.1 Gene:pxdn / 493201 XenbaseID:XB-GENE-923300 Length:1460 Species:Xenopus tropicalis


Alignment Length:243 Identity:72/243 - (29%)
Similarity:110/243 - (45%) Gaps:43/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 LCRQTPRLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIK 522
            ||.:| .::.:.|...|:..:|..::     :|||..|:|:.||...|..||.||.|||:.|:||
 Frog    34 LCFRT-TVRCMHLMLESVPAVPPHTT-----ILDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIK 92

  Fly   523 ALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPEL-PESGLRALLHLKTF 586
            .:|.:||:.:..|:.|.|..|||..|.::||.|..:||.|.|..|....| |||          |
 Frog    93 RIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPES----------F 147

  Fly   587 NN-PKLREF---------PPPDTFPRIQTL----ILSYAYHC-CAFL---PLVAMSSQKKTSQVQ 633
            |. |||...         ..|.||.:::::    :.|.|.|| |..|   .|:.:.|:...:|. 
 Frog   148 NYLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQA- 211

  Fly   634 EAVLFPSDAEFDMTLWNNSMMNIWPQMHNLSKQLGASMHDPWETAINF 681
                 .:..|:...|...|:..|.|...|..:....|  :|.:..:.|
 Frog   212 -----AATCEYPRRLQGRSVSTITPSELNCERPRITS--EPQDVDVTF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
LRR_8 299..359 CDD:290566
leucine-rich repeat 301..324 CDD:275380
leucine-rich repeat 325..348 CDD:275380
LRR_RI 327..567 CDD:238064 41/108 (38%)
leucine-rich repeat 349..371 CDD:275380
LRR_8 370..425 CDD:290566
leucine-rich repeat 372..393 CDD:275380
leucine-rich repeat 394..415 CDD:275380
leucine-rich repeat 418..486 CDD:275380 6/27 (22%)
leucine-rich repeat 441..464 CDD:275378 3/5 (60%)
LRR_8 487..545 CDD:290566 25/57 (44%)
leucine-rich repeat 487..510 CDD:275380 9/22 (41%)
leucine-rich repeat 511..534 CDD:275380 11/22 (50%)
LRR_8 533..589 CDD:290566 21/57 (37%)
leucine-rich repeat 535..558 CDD:275380 10/22 (45%)
leucine-rich repeat 559..580 CDD:275380 9/21 (43%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
pxdnNP_001076815.1 leucine-rich repeat 38..56 CDD:275380 4/18 (22%)
LRR <54..235 CDD:227223 63/201 (31%)
leucine-rich repeat 57..80 CDD:275380 9/27 (33%)
LRR_8 104..163 CDD:338972 24/68 (35%)
leucine-rich repeat 105..128 CDD:275378 10/22 (45%)
leucine-rich repeat 129..152 CDD:275378 11/32 (34%)
leucine-rich repeat 153..176 CDD:275378 4/22 (18%)
leucine-rich repeat 177..189 CDD:275378 2/11 (18%)
I-set 239..326 CDD:369462 3/16 (19%)
I-set 335..422 CDD:369462
Ig3_Peroxidasin 439..512 CDD:143222
Ig4_Peroxidasin 535..603 CDD:143223
peroxidasin_like 856..1295 CDD:188658
VWC 1402..1452 CDD:214564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.