DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AgaP_AGAP010675

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_001237382.2 Gene:AgaP_AGAP010675 / 4577685 VectorBaseID:AGAP010675 Length:365 Species:Anopheles gambiae


Alignment Length:279 Identity:81/279 - (29%)
Similarity:116/279 - (41%) Gaps:86/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 KLRTLRLEGNLFYRIPT---NALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMK 337
            |::.:..|.:...|||.   ||...||:|...|  :||.:::......|      |....|||.:
Mosquito    64 KVQHVAFEDSTLDRIPAELLNAFPNLRSLSVPN--ANLSSVVIPAKLER------LYASDNQISQ 120

  Fly   338 ISAGALKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRAN 402
            :.....::.|.:..|.||.|.:..: ..|::|::|:.||::.||       |||     :|    
Mosquito   121 VIVHQTRDTTTMLELILDSNRLHDI-SNLTRLAKLEILSLSGNR-------ELP-----ID---- 168

  Fly   403 PLSTISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEV--PANLCRQTPRL 465
              .||..|.|:||..||.|:||||          ..|.||       ..|||  ||         
Mosquito   169 --DTIELGRFKGMDGLRHLLLSDV----------GAHHLE-------NEQEVSLPA--------- 205

  Fly   466 KSLELKTNSLKRIPNLSSCRDLRLLDLSSNQI--EKIQGKPFNGLKQLNDLLLSYNRIKALPQDA 528
                                 |.|||||||.:  ..:..|.|...|.|..|.|:||:::.|  |.
Mosquito   206 ---------------------LELLDLSSNNLPPSYLSVKVFAPFKSLQILRLAYNQLREL--DV 247

  Fly   529 FQ---GIPKLQLLDLEGNE 544
            .|   ..|:|:.:.|||||
Mosquito   248 LQLTKNNPQLKQIYLEGNE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 30/109 (28%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566 12/37 (32%)
leucine-rich repeat 253..276 CDD:275380 81/279 (29%)
leucine-rich repeat 277..300 CDD:275380 7/25 (28%)
LRR_8 299..359 CDD:290566 15/59 (25%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
leucine-rich repeat 325..348 CDD:275380 4/22 (18%)
LRR_RI 327..567 CDD:238064 67/225 (30%)
leucine-rich repeat 349..371 CDD:275380 6/21 (29%)
LRR_8 370..425 CDD:290566 19/54 (35%)
leucine-rich repeat 372..393 CDD:275380 8/20 (40%)
leucine-rich repeat 394..415 CDD:275380 5/20 (25%)
leucine-rich repeat 418..486 CDD:275380 15/69 (22%)
leucine-rich repeat 441..464 CDD:275378 7/24 (29%)
LRR_8 487..545 CDD:290566 26/63 (41%)
leucine-rich repeat 487..510 CDD:275380 10/24 (42%)
leucine-rich repeat 511..534 CDD:275380 8/25 (32%)
LRR_8 533..589 CDD:290566 7/12 (58%)
leucine-rich repeat 535..558 CDD:275380 6/10 (60%)
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AgaP_AGAP010675XP_001237382.2 leucine-rich repeat 65..88 CDD:275380 6/22 (27%)
leucine-rich repeat 89..107 CDD:275380 6/19 (32%)
leucine-rich repeat 108..131 CDD:275380 5/28 (18%)
leucine-rich repeat 132..153 CDD:275380 6/21 (29%)
LRR_RI <134..267 CDD:238064 62/201 (31%)
LRR_4 134..169 CDD:289563 15/53 (28%)
leucine-rich repeat 154..181 CDD:275380 15/44 (34%)
LRR_8 181..242 CDD:290566 31/107 (29%)
leucine-rich repeat 182..205 CDD:275380 13/39 (33%)
leucine-rich repeat 206..231 CDD:275380 10/24 (42%)
leucine-rich repeat 232..256 CDD:275380 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.