DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AgaP_AGAP007462

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_001237076.2 Gene:AgaP_AGAP007462 / 4576240 VectorBaseID:AGAP007462 Length:400 Species:Anopheles gambiae


Alignment Length:277 Identity:65/277 - (23%)
Similarity:112/277 - (40%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 VVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDPNA----------FYGLAKLKRLSLQ 235
            :..|.|..|.|.:|:...|...|.|.||.::||.|:.:|.:|          :.|..||..|.|:
Mosquito   158 IAKLYLAGNVLERLDMAVFVAMPLLSELYITDNRIVTLDVSAPIALPNLSDLYLGYNKLVSLDLR 222

  Fly   236 NCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRT 300
            |..|..:...|| |...||.:.:    |..|       :.|...:.|..|...::..:.......
Mosquito   223 NLTLPKVETFSF-GPNALTQMPI----LPRL-------MPKFNYISLFANNLTQLDMSYFRPYSN 275

  Fly   301 LEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQI--MKISAGALKNLTALKVLELDDNLISSLP 363
            |:.:::.||.:|.:......|:| |:.|:|..|:|  ..|:...:.|:|   :|.||.|.::.:|
Mosquito   276 LQNIHITSNQITTVRASSPVRLP-LVHLVLTDNKITTFNITGWDMPNIT---LLNLDGNRLTLVP 336

  Fly   364 EGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPGAFR----GMSKLRKLILS 424
            ....:                     .|:.:.::|....|.:.:||...|    .:.|.::.:|.
Mosquito   337 PVFDR---------------------YPKVVLVMDRNPLPCNALSPFKDRLNNDQLQKEQRPLLM 380

  Fly   425 DVRTLRSF---PELEAC 438
            ...|..||   ..|:||
Mosquito   381 ACTTTSSFAIDETLKAC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 51/213 (24%)
leucine-rich repeat 183..204 CDD:275380 6/20 (30%)
LRR_8 203..263 CDD:290566 21/69 (30%)
leucine-rich repeat 205..228 CDD:275380 9/32 (28%)
leucine-rich repeat 229..252 CDD:275380 8/22 (36%)
LRR_8 252..311 CDD:290566 10/58 (17%)
leucine-rich repeat 253..276 CDD:275380 4/22 (18%)
leucine-rich repeat 277..300 CDD:275380 2/22 (9%)
LRR_8 299..359 CDD:290566 18/61 (30%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
leucine-rich repeat 325..348 CDD:275380 7/24 (29%)
LRR_RI 327..567 CDD:238064 26/121 (21%)
leucine-rich repeat 349..371 CDD:275380 5/21 (24%)
LRR_8 370..425 CDD:290566 8/58 (14%)
leucine-rich repeat 372..393 CDD:275380 1/20 (5%)
leucine-rich repeat 394..415 CDD:275380 5/24 (21%)
leucine-rich repeat 418..486 CDD:275380 7/24 (29%)
leucine-rich repeat 441..464 CDD:275378
LRR_8 487..545 CDD:290566
leucine-rich repeat 487..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
LRR_8 533..589 CDD:290566
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AgaP_AGAP007462XP_001237076.2 LRR_8 106..168 CDD:290566 3/9 (33%)
leucine-rich repeat 108..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380
leucine-rich repeat 156..181 CDD:275380 6/22 (27%)
LRR_8 157..216 CDD:290566 16/57 (28%)
LRR <180..>337 CDD:227223 44/172 (26%)
leucine-rich repeat 182..205 CDD:275380 8/22 (36%)
leucine-rich repeat 206..228 CDD:275380 7/21 (33%)
leucine-rich repeat 229..251 CDD:275380 7/33 (21%)
leucine-rich repeat 252..275 CDD:275380 2/22 (9%)
leucine-rich repeat 276..297 CDD:275380 4/20 (20%)
leucine-rich repeat 299..321 CDD:275380 6/21 (29%)
leucine-rich repeat 345..356 CDD:275378 1/10 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.