DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AgaP_AGAP007461

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_001237077.2 Gene:AgaP_AGAP007461 / 4576239 VectorBaseID:AGAP007461 Length:384 Species:Anopheles gambiae


Alignment Length:363 Identity:86/363 - (23%)
Similarity:153/363 - (42%) Gaps:88/363 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 FFM--APNLEELTLSDN---SIINMD-------PNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLA 251
            :|:  ||.|..:.|..|   |:::::       |.....:..|.||::::|.::.|....|..|.
Mosquito    53 YFLHKAPLLRYVYLQHNVNVSLLHIEHCSLTGMPRTIRNVPNLLRLAIKSCRIRHLDLNDFADLH 117

  Fly   252 QLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIIND 316
            .|.|:.|..|.:|                                   |:..|...|:|:..||.
Mosquito   118 SLYSVDLTNNRIV-----------------------------------TITELLPASDLVLPINR 147

  Fly   317 EDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNR 381
                       |.|..|.:.:::..||..||.|..|.|:.|.|..:...:: |.:|:|||:.:||
Mosquito   148 -----------LYLANNSLTQLNVRALGALTDLHCLVLEGNRIEEVNSPIA-LPKLEELSLRNNR 200

  Fly   382 LRWINDT--ELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEIL 444
            ::.:|.|  .|| :::.|....|.|| |:|..::.|.::..|.|| ...|.|| .::..:..::.
Mosquito   201 IKQLNCTGWHLP-ALKYLFCSGNRLS-IAPIEWQSMWRIEVLDLS-FNLLHSF-RMDDIYLTQLY 261

  Fly   445 KLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLK 509
            .|:.||.|.....    ||::..         |:|       |..|.|:.|::..:....:: :.
Mosquito   262 ALNLAGNQLTSVT----TPQMHF---------RVP-------LSRLWLAQNRLPVLDISRWD-MP 305

  Fly   510 QLNDLLLSYNRIKALPQDAFQGIPKL-QLLDLEGNEIS 546
            .|.:|.:::||:..| .|.|...|.| .::.|..|:.|
Mosquito   306 NLWELDVAHNRLTEL-ADVFVRFPNLAPMMILRNNQWS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 45/195 (23%)
leucine-rich repeat 183..204 CDD:275380 2/6 (33%)
LRR_8 203..263 CDD:290566 17/69 (25%)
leucine-rich repeat 205..228 CDD:275380 5/32 (16%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..311 CDD:290566 8/58 (14%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 0/22 (0%)
LRR_8 299..359 CDD:290566 17/59 (29%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
leucine-rich repeat 325..348 CDD:275380 6/22 (27%)
LRR_RI 327..567 CDD:238064 60/223 (27%)
leucine-rich repeat 349..371 CDD:275380 6/21 (29%)
LRR_8 370..425 CDD:290566 19/56 (34%)
leucine-rich repeat 372..393 CDD:275380 10/22 (45%)
leucine-rich repeat 394..415 CDD:275380 6/20 (30%)
leucine-rich repeat 418..486 CDD:275380 14/67 (21%)
leucine-rich repeat 441..464 CDD:275378 5/22 (23%)
LRR_8 487..545 CDD:290566 15/58 (26%)
leucine-rich repeat 487..510 CDD:275380 4/22 (18%)
leucine-rich repeat 511..534 CDD:275380 7/22 (32%)
LRR_8 533..589 CDD:290566 5/15 (33%)
leucine-rich repeat 535..558 CDD:275380 4/13 (31%)
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AgaP_AGAP007461XP_001237077.2 LRR_8 71..129 CDD:290566 13/57 (23%)
leucine-rich repeat 72..94 CDD:275380 2/21 (10%)
LRR_RI 78..319 CDD:238064 71/312 (23%)
leucine-rich repeat 95..118 CDD:275380 7/22 (32%)
leucine-rich repeat 119..146 CDD:275380 9/61 (15%)
LRR_8 147..201 CDD:290566 18/65 (28%)
leucine-rich repeat 147..168 CDD:275380 6/31 (19%)
LRR_4 169..205 CDD:289563 12/36 (33%)
leucine-rich repeat 169..190 CDD:275380 6/21 (29%)
LRR_8 189..247 CDD:290566 20/60 (33%)
leucine-rich repeat 191..213 CDD:275380 10/22 (45%)
leucine-rich repeat 214..236 CDD:275380 7/22 (32%)
leucine-rich repeat 237..259 CDD:275380 6/23 (26%)
leucine-rich repeat 307..329 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.